Dbfetch

ID   AH005437; SV 2; linear; genomic DNA; STD; MUS; 3958 BP.
XX
AC   AH005437; L05436-L05439;
XX
DT   13-JUN-2016 (Rel. 129, Created)
DT   13-JUN-2016 (Rel. 129, Last updated, Version 1)
XX
DE   Mus musculus domesticus strain BALB/c IGFBP-2 (IGFBP-2) gene, complete cds.
XX
KW   .
XX
OS   Mus musculus domesticus (western European house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3958
RX   DOI; 10.1016/0378-1119(93)90406-S.
RX   PUBMED; 7680327.
RA   Landwehr J., Kaupmann K., Heinrich G., Schwander J.;
RT   "Cloning and characterization of the gene encoding murine insulin-like
RT   growth factor-binding protein-2, mIGFBP-2";
RL   Gene 124(2):281-286(1993).
XX
DR   MD5; 2eb67856529f04c52316d0c501515365.
XX
CC   On or before Jun 10, 2016 this sequence version replaced gi:194490,
CC   gi:975242, gi:194492, gi:194493, gi:2182262.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3958
FT                   /organism="Mus musculus domesticus"
FT                   /map="proximal region of chromosome 1"
FT                   /sub_species="domesticus"
FT                   /strain="BALB/c"
FT                   /mol_type="genomic DNA"
FT                   /sex="female"
FT                   /tissue_type="fetal liver"
FT                   /db_xref="taxon:10092"
FT   5'UTR           1..82
FT   gene            83..3958
FT                   /gene="IGFBP-2"
FT   exon            83..2364
FT                   /gene="IGFBP-2"
FT                   /number=1
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   CDS             join(1980..2364,2556..2782,3140..3280,3453..3617)
FT                   /codon_start=1
FT                   /gene="IGFBP-2"
FT                   /protein_id="AAB60709.1"
FT                   /translation="MLPRLGGPALPLLLPSLLLLLLLGAGGCGPGVRAEVLFRCPPCTP
FT                   ERLAACGPPPDAPCAELVREPGCGCCSVCARQEGEACGVYIPRCAQTLRCYPNPGSELP
FT                   LKALVTGAGTCEKRRVGTTPQQVADSDDHHSEGGLVENHVDGTMNMLGGGSSAGRKPLK
FT                   SGMKELAVFREKVNEQHRQMGKGAKHLSLEEPKKLRPPPARTPCQQELDQVLERISTMR
FT                   LPDDRGPLEHLYSLHIPNCDKHGRYNLKQCKMSLNGQRGECWCVNPNTGKPIQGAPTIR
FT                   GDPECHLFYNEQQETGGAHAQSVQ"
FT   gap             2434..2533
FT                   /estimated_length=unknown
FT   exon            2556..2782
FT                   /gene="IGFBP-2"
FT                   /number=2
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   gap             2802..2901
FT                   /estimated_length=unknown
FT   exon            3140..3280
FT                   /gene="IGFBP-2"
FT                   /number=3
FT                   /note="putative"
FT   gap             3327..3426
FT                   /estimated_length=unknown
FT   exon            3453..>3958
FT                   /gene="IGFBP-2"
FT                   /number=4
FT                   /note="putative"
FT   3'UTR           3618..3958
FT                   /gene="IGFBP-2"
FT   regulatory      3922..3927
FT                   /gene="IGFBP-2"
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 3958 BP; 773 A; 955 C; 1090 G; 840 T; 300 other;
     ccacttcttc ttctctctct ctcttttttt cttttgagac caggctccgt gtaaccttgg        60
     ctgtcctgga tcttgcttca cagaccaggc tgcttggaac ccagggattt gcctgactct       120
     gctgtccaag tgctgggatt aaaggcctca ccgccataca gactctttac tgtgttttat       180
     gcagaggtag gaatatagct agcaatgtgg ctctcacttt acaatggatg tttatggcac       240
     accatgatgc agggtggtat ctctactaca aggagtcctc agtcggtgag gccaatagga       300
     acatattcca gggcaggtac aagacaccag aacacgtgga gatgtgaact ggagcctccc       360
     ccagaatttg ttggtttcct tctgttagat cgccattctg tatagctccc attattgtca       420
     gaggtccatc cctctgctca aacactgatg ctgtgtcctg acacgcccaa atcaggccaa       480
     gtctcagcac tagctgattt ccctgccagt tcccctatct ccccaggggt tttgatctct       540
     ggcctaagtg actttctagt ttcagtatca ctcttcaatt ttttttcatc atttctgctg       600
     gtccgggtgt tgagatgcgc atgatacctc catttccctc tacgcaatta ccaagcttta       660
     gtctcacacc cctccccttc tttttcattc ggatagtcat caaccacaga ggttcctaca       720
     gaagttcaaa ctctcctccg aggcacaacc tctcctagtt tcttaagatt agaactttgt       780
     cttctaggag gcataaactc aacagacata tgacaaagcc gctgaattga gataggccct       840
     gagcccagaa attagaaagg atggctggag aatcttgtgg gatggagacg cctcactcgt       900
     tgttaaggtc acaaccctgg caaatgagtc aataactaag gtcctgccag gctggagtga       960
     tggaggttgg gggcaactag gctgggtgat tcaattggaa caaaggaggc agccactctt      1020
     ttctatttga aacctgagcg agctctaatc agcctaggcc taggcctagg gctttctcta      1080
     atacctgggg aggggggtgg gtgttctaat ctgacctttt caagacccct tcagtgggtg      1140
     tgtcttcaga cgtcttgggg ggggagcggg gagagtgtgt gtaaaggttg ggcgaataag      1200
     gcagcgtttg tggatggtga cccgggtctc taggggatta gagggcttgt ggggcagagg      1260
     tttgtgaggc accaggaaac tctccaggtt tcattacttg cagcggtgag ctctgggctg      1320
     ggaaactgaa gttgttgcta ggaggtgctg tctgggacga gcctggtcta gaaggactga      1380
     gtgtccgcgg actcactcaa ggtcattgtt cctagcaact cgagggctgt ggggagtcgg      1440
     ctccgaaatc tttaaggtca agactgcttt tgtgtttccc cggcagttca gtcacagccg      1500
     gccacgtggg aagtgagcaa actaagtcct tccaaatcga actaaactaa aagacaggag      1560
     acaaaagcac aggctctttc cactccacgc cgattctacc cacgcttgca agttattctt      1620
     actctcccgg agcggacaaa cccaggctga agggagcaaa gtcctaacca gggaagaaca      1680
     gaggggtccg cttgaatccc taggaacgta gggtgggcga gtgggcgtgt gcacaagcca      1740
     gtgccctcac gcaagagtgc gggggggggc ggtgcggggg ggggcggtgc gggggggggg      1800
     ggaagggagt ggtctccata agggggaggg gagaaggcag gggggcgggg agaagcaggt      1860
     ttttaggacc cggcagaggc gggggaggag aaagaaggca aggaggcgtc ttcccgcatt      1920
     cgtcttgggc cgtgcacctg cccgctagct cgctcgactg ccgttgccca caagccaaca      1980
     tgctgccgag attgggcggc cccgcgctgc cgctgctcct gccgtcgttg ctcttgctgc      2040
     tgctcttggg cgcgggcggc tgcggccccg gggtgcgcgc cgaggtgctg ttccgctgcc      2100
     caccctgcac gcccgagcgt ctggccgctt gcgggccccc acccgacgcg ccctgcgccg      2160
     agctggtgcg agagcccggc tgcggctgct gctccgtgtg cgcacggcag gagggcgaag      2220
     catgcggcgt ctacatcccg cgctgcgccc agacgctacg ctgctatccc aacccgggct      2280
     ccgagctgcc cctgaaggcg cttgtcacag gcgcgggtac ctgtgaaaag agacgcgtgg      2340
     gcaccacccc acagcaggtt gcaggtaatg cggactgtga gcactagttt tgggcttggg      2400
     agaaactctc tcgtagctca ggcgttctcc tggnnnnnnn nnnnnnnnnn nnnnnnnnnn      2460
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2520
     nnnnnnnnnn nnnatcctct agagtcgact tgcagacagt gatgaccacc actctgaggg      2580
     aggcctggtg gagaaccacg tggatgggac catgaacatg ttgggaggtg gtagcagtgc      2640
     tggccggaag cccctcaagt caggcatgaa ggagctggct gtgttccggg agaaggtcaa      2700
     tgaacagcac cggcagatgg gcaagggtgc caaacacctc agtctggagg agcccaagaa      2760
     gttgcgcccg cctcccgcca gggtcagtgg tggggtctga tnnnnnnnnn nnnnnnnnnn      2820
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2880
     nnnnnnnnnn nnnnnnnnnn ncaggtcagt gtggatgggt ctatgagaag cctgctactg      2940
     acaaacaaac ctaacaacag tcatgtgact ttctgaggat ggatgagcac agtaaattgg      3000
     tgacactgat actgccctac tagccgcttg gtgttgaggg agtctcttct cacggatcag      3060
     gcagtgtgtg agccaagcct agtaccagtg ttttgtgggc tcctttccct catgctaggc      3120
     gctccttttt tgtcttcaga ccccttgcca gcaggagttg gaccaggtcc tggagcggat      3180
     ctccaccatg cgccttccgg atgatcgggg ccccctggaa catctctact ccctgcacat      3240
     ccccaactgt gacaagcatg gccggtacaa ccttaagcag gtgagtgtgg gccagcctgg      3300
     gctagggagg cctcctcagc ccggagnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      3360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      3420
     nnnnnncatg ttttcctctt tttacccttc agtgcaagat gtctctgaac ggacagcgcg      3480
     gggagtgctg gtgtgtgaac cccaataccg ggaagcccat ccagggagct cccaccatcc      3540
     ggggagaccc cgagtgccat ctcttctaca acgagcagca ggagactggt ggggcccatg      3600
     cccaaagtgt gcagtaaacc ccaccgagtc ggtccgtcgg ttccccatcc cgaacaccag      3660
     cagaaatgga gggcgctagg gtagcgggtg tggaggagtt cccagttttg acacatgtat      3720
     ttatatttgg aaagagacca acactgagct cagaagcccc cctctgaccc cccccagcgg      3780
     ctgttaactg aacctccttg cttctgttag agagggggga aggggtggta tggagggcac      3840
     tgggtacagg cctgggaatg gggaaagaaa tttttatttt tgaatccctg tgtctctttt      3900
     gcttaagatt aaaggaagga aaataaaagc tgctgctgtc ttacttgagt ctttgggg        3958
//