Dbfetch

ID   L02545; SV 1; linear; mRNA; STD; HUM; 826 BP.
XX
AC   L02545;
XX
DT   24-SEP-1992 (Rel. 33, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 11)
XX
DE   Homo sapiens (clone HLA-DR2/1-4) MHC class II HLA-DR beta-1 (HLA-DRB1)
DE   mRNA, complete cds.
XX
KW   cell surface glycoprotein; class II gene; HLA-DR beta-1;
KW   integral membrane protein.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-826
RX   DOI; 10.1007/BF00222476.
RX   PUBMED; 8436426.
RA   Rosenlicht J.W., Hartung K., Deicher H., Frey J.;
RT   "A novel HLA-DRB1-DR2 allele associated with HLA mistyping";
RL   Immunogenetics 37(6):479-479(1993).
XX
DR   MD5; 0ea53d4f321a48a6cc2c5b7a202e45de.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..826
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /haplotype="HLA-A2/-A11,-B39/-B60,-Cw3/-Cw7,
FT                   -DR15/-DR4/-DRw53,-DQ6/-DQ8"
FT                   /dev_stage="adult"
FT                   /cell_type="leukocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   5'UTR           1..14
FT                   /partial
FT                   /gene="HLA-DRB1"
FT                   /note="changed due to PCR primer sequence; G00-120-642;
FT                   putative"
FT   sig_peptide     15..101
FT                   /gene="HLA-DRB1"
FT                   /note="G00-120-642"
FT   CDS             15..815
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II HLA-DR-beta"
FT                   /db_xref="GOA:Q29974"
FT                   /db_xref="H-InvDB:HIT000191486_02.4"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*16:03"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29974"
FT                   /protein_id="AAA59777.1"
FT                   /translation="MVCLKLPGGSCMTALTVTLMVLSSPLALAGDTRPRFLWQPKRECH
FT                   FFNGTERVRFLDRYFYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDFLEDRAAAV
FT                   DTYCRHNYGVGESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLN
FT                   GQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSE
FT                   SAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS"
FT   mat_peptide     102..812
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II HLA-DR-beta"
FT                   /function="immune regulation"
FT                   /note="(pos: 'ttc', aa: Phe ); (seq: 'gcc', aa: Ala );
FT                   G00-120-642"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   3'UTR           816..826
FT                   /partial
FT                   /gene="HLA-DRB1"
FT                   /note="changed due to PCR primer sequence; G00-120-642;
FT                   putative"
XX
SQ   Sequence 826 BP; 182 A; 214 C; 261 G; 169 T; 0 other;
     tcctgaattc cagcatggtg tgtctgaagc tccctggagg ctcctgcatg acagcgctga        60
     cagtgacact gatggtgctg agctccccac tggctttggc tggggacacc cgaccacgtt       120
     tcctgtggca gcctaagagg gagtgtcatt tcttcaatgg gacggagcgg gtgcggttcc       180
     tggacagata cttctataac caggaggagt ccgtgcgctt cgacagcgac gtgggggagt       240
     accgggcggt gacggagctg gggcggcctg acgctgagta ctggaacagc cagaaggact       300
     tcctggaaga cagggccgcc gcggtggaca cctactgcag acacaactac ggggttggtg       360
     agagcttcac agtgcagcgg cgagtccaac ctaaggtgac tgtatatcct tcaaagaccc       420
     agcccctgca gcaccacaac ctcctggtct gctctgtgag tggtttctat ccaggcagca       480
     ttgaagtcag gtggttcctg aacggccagg aagagaaggc tgggatggtg tccacaggcc       540
     tgatccagaa tggagactgg accttccaga ccctggtgat gctggaaaca gttcctcgaa       600
     gtggagaggt ttacacctgc caagtggagc acccaagcgt gacaagccct ctcacagtgg       660
     aatggagagc acggtctgaa tctgcacaga gcaagatgct gagtggagtc gggggctttg       720
     tgctgggcct gctcttcctt ggggccgggc tgttcatcta cttcaggaat cagaaaggac       780
     actctggact tcagccaaca ggattcctga gctgaagtcg acatga                      826
//