spacer

EBI Dbfetch

ID   L01776; SV 1; linear; mRNA; STD; MUS; 9014 BP.
XX
AC   L01776;
XX
DT   15-SEP-1992 (Rel. 33, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 10)
XX
DE   Mus musculus neuronal dihydropyridine-sensitive L-type calcium channel
DE   alpha-1 subunit mRNA, complete cds.
XX
KW   dihydropyridine-sensitive calcium channel; L-type calcium channel;
KW   neuronal calcium channel alpha-1 subunit.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-9014
RX   PUBMED; 1385406.
RA   Ma W.-J., Holz R.W., Uhler M.D.;
RT   "Expression of a cDNA for a neuronal calcium channel alpha 1 subunit
RT   enhances secretion from adrenal chromaffin cells";
RL   J Biol Chem 267(32):22728-22732(1992).
XX
DR   Ensembl-Gn; ENSMUSG00000051331; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078320; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112825; mus_musculus.
DR   EuropePMC; PMC23052; 10535984.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..9014
FT                   /organism="Mus musculus"
FT                   /sub_species="domesticus"
FT                   /strain="BALB/c"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /tissue_lib="lambda GT11"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:10090"
FT   5'UTR           1..1166
FT   misc_difference 1120
FT                   /replace="t"
FT                   /note="sequence difference between two clones"
FT   CDS             1167..7586
FT                   /codon_start=1
FT                   /product="L-type calcium channel alpha-1"
FT                   /db_xref="GOA:Q01815"
FT                   /db_xref="InterPro:IPR002077"
FT                   /db_xref="InterPro:IPR005446"
FT                   /db_xref="InterPro:IPR005451"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR014873"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="MGI:MGI:103013"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q01815"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="AAB59633.1"
FT                   /translation="MVNENTRMYVPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPT
FT                   PGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPKKQGGTTATRPPRAL
FT                   LCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVE
FT                   YLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGAN
FT                   ALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIII
FT                   YAIIGLELFMGKMHKTCYNQEGIIDVPAEEDPSPCALETGHGRQCQNGTVCKPGWDGPK
FT                   HGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNL
FT                   VLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGMDE
FT                   DKPRNMSMPTSETESVNTENVAGGDIEGENCGARLAHRISKSKFSRYWRRWNRFCRRKC
FT                   RAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPHWLTEVQDTANKALLALFTAEMLLKMY
FT                   SLGLQAYFVSLFNRFDCFIVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWN
FT                   SLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQ
FT                   SLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAV
FT                   DNLADAESLTSAQKEEEEEKERKKLARTASPEKKQEVMEKPAVEESKEEKIELKSITAD
FT                   GESPPTTKINMDDLQPSENEDKSPHSNPDTAGEEDEEEPEMPVGPRPRPLSELHLKEKA
FT                   VPMPEASAFFIFSPNNRFRLQCHRIVNDTIFTNLILFFILLSSISLAAEDPVQHTSFRN
FT                   HILGNADYVFTSIFTLEIILKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSS
FT                   AINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGV
FT                   QLFKGKLYTCSDSSKQTEAECKGNYITYKDGEVDHPIIQPRSWENSKFDFDNVLAAMMA
FT                   LFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVI
FT                   VTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYLM
FT                   FVLILLNTICLAMQHYGQSCLFKIAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWN
FT                   VFDFLIVIGSIIDVILSETNPAEHTQCSPSMSAEENSRISITFFRLFRVMRLVKLLSRG
FT                   EGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTF
FT                   PQAVLLLFRCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYM
FT                   LCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTL
FT                   LRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLE
FT                   QANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQG
FT                   LVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFR
FT                   RAGGLFGNHVTYYQSDSRGNFPQTFATQRPLHINKTGNNQADTESPSHEKLVDSTFTPS
FT                   SYSSTGSNANINNANNTALGRFPHPAGYSSTVSTVEGHGPPLSPAVRVQEAAWKLSSKR
FT                   CHSRESQGATVNQEIFPDETRSVRMSEEAEYCSEPSLLSTDMFSYQEDEHRQLTCPEED
FT                   KREIQPSPKRSFLRSASLGRRASFHLECLKRQKDQGGDISQKTALPLHLVHHQALAVAG
FT                   LSPLLQRSHSPTTFPRPCPTPPVTPGSRGRPLRPIPTLRLEGAESSEKLNSSFPSIHCS
FT                   SWSEETTACSGSSSMARRARPVSLTVPSQAGAPGRQFHGSASSLVEAVLISEGLGQFAQ
FT                   DPKFIEVTTQELADACDMTIEEMENAADNILSGGAQQSPNGTLLPFVNCRDPGQDRAVA
FT                   PEDESCAYALGRGRSEEALADSRSYVSNL"
FT   misc_difference 3505..3506
FT                   /replace="accggccag"
FT                   /note="splicing variation within a clone"
FT   3'UTR           7587..9014
FT   misc_difference 8238..8239
FT                   /replace="ggagg"
FT                   /note="sequence insertion within a clone"
XX
SQ   Sequence 9014 BP; 2087 A; 2439 C; 2375 G; 2113 T; 0 other;
     gtgtgttgca catgtctgtg tgagtacagg cacacatgtg catgcaagtg gttgcagaag        60
     gcagaagatc actttggatc ccttggggct ggagttatag gtgcttgtga gccaccagac       120
     atggtacttg taattgagaa gcaagtggtc ccaaccacag tgccatctct ccagctccca       180
     ctttctttct ttttgaccac aactctcccc tttataaaag aggaagaaag ttattcccaa       240
     gccggggaaa cactcacaac aggctccttc ttttaactta gtggagaagt cggggcagcc       300
     tcaaaaacag tgagtaggtc acaactctag tactctacta agcacttgag caaattacaa       360
     gatagcaatt ggtatgcagg agccaaagta tgatgagggt tggatgagca tgtgctaagc       420
     acagccatcc tcttttgtct taattggagc agatatactg caagcctctc tctgtctaga       480
     gataacgttt attttatttg gatgcatgag tattttgctt acatgtatgt atgggtacta       540
     tgtgtgtgcc tggagcctgc agtggtcacg agaggggatc agatcccatg gaacggagct       600
     cggcgcggcg cggcccggag cggcggcggc agtggcggcg gcggcgacgc ttcccgcggg       660
     ctcgccctca ggtgttcgcg gctgccgtcg ccgaagatcg cgggtcgggg cctcgcggcg       720
     atcgccctgg gcgggccgga gacgcctcgg gccccctggc ggctcggggt ccacccggcg       780
     ccgcgggccc gccgctttcc ctcgcctcgc ctttgcgcct cttctcgctc tgcctctcca       840
     tttattattc ttatcatttt tattttcaaa tggtgtagcc gccagaggtg cggtgctaaa       900
     ttcttggaag gggcccggat gtactgagga tgcattacaa tctcacgaaa ggaggcggta       960
     gtggaaagca gcagtttttg gtgtttggtg caataatggg gatcaggtaa tcacccgaag      1020
     ggagcaagaa ccactgcgga tccacggctt cctggatttg cgcgagagcc gccggcctcg      1080
     gaggagggat ccatcccgag ccgctcgcgg ctgttgctgc atttcttcct ctttgtggct      1140
     tctcctttcc aagcagtttt tggccaatgg tcaatgaaaa cacgaggatg tacgttccag      1200
     aggaaaacca ccaaggttcc aactatggga gcccacgccc agctcatgcc aacatgaatg      1260
     ccaatgcagc tgcaggactt gctcccgagc acatccctac tccaggggca gcactgtcct      1320
     ggcaggcagc catcgatgcc gcccggcagg ccaagctcat gggcagtgct ggcaacgcaa      1380
     ccatctctac cgtcagttcc acacagcgga agcggcagca gtatgggaaa cccaagaagc      1440
     aggggggcac aaccgccaca cggccgcccc gggctctgct gtgtctgacc ctgaagaacc      1500
     ctatccggag ggcgtgcata agcattgttg aatggaaacc atttgaaatc attattttac      1560
     tgactatttt tgccaattgt gtggccttag caatctatat tccctttccg gaagacgact      1620
     ccaacgccac caactccaac ctggaacgag tggagtatct cttcctcatc atttttaccg      1680
     tggaagcatt tttaaaagta attgcctacg gacttctctt ccaccccaac gcttacctcc      1740
     gcaatggttg gaatttactg gattttataa tcgtggttgt agggcttttt agtgcaattt      1800
     tagaacaagc aaccaaagct gatggggcca atgctctagg agggaaagga gctggattcg      1860
     acgtgaaggc actgagagcg ttccgcgtgc tccgtccact gcggctagtg tccggagtcc      1920
     caagtctcca ggtggtcctg aactccatca tcaaggccat ggtgcctctg ctgcacattg      1980
     cccttcttgt gctcttcgtc atcatcattt atgctattat cggcctggag ctcttcatgg      2040
     gaaagatgca caagacctgc tacaaccagg agggcataat agatgttccg gcagaagagg      2100
     atccttcccc ttgtgctttg gagacaggcc atgggcgaca gtgtcagaac gggaccgtgt      2160
     gcaaacccgg gtgggatggg cccaagcacg gcatcaccaa cttcgacaac ttcgccttcg      2220
     ccatgctgac ggtgttccag tgtatcacca tggagggctg gacagacgtg ctgtactgga      2280
     tgcaagacgc tatgggctat gagttgccct gggtgtattt tgtcagtctg gtcatctttg      2340
     gatccttttt cgttctaaat ctggttctcg gtgttttgag cggggagttt tccaaagaga      2400
     gggagaaagc caaagcccga ggagatttcc agaagcttcg agagaagcag caactagaag      2460
     aagatctcaa aggctacctg gactggatca cccaggcaga agacattgac cccgagaatg      2520
     aggacgaggg catggatgaa gacaagcctc gaaacatgag catgcccaca agtgagactg      2580
     agtctgtcaa cactgaaaac gtggctggag gtgacatcga gggagaaaac tgtggagcca      2640
     ggcttgccca tcggatctcc aaatccaaat tcagccgcta ctggcgcagg tggaatcgat      2700
     tctgcagaag aaaatgccgt gcagcagtta agtccaacgt cttctactgg ctcgtgatct      2760
     tcctggtgtt cctcaacacc ctcaccattg cctccgaaca ttacaaccag cctcactggc      2820
     tcacagaagt gcaagacaca gccaataaag ccctcctggc ccttttcact gcagaaatgc      2880
     tcctgaagat gtacagcctg ggtcttcagg cctattttgt gtccctcttc aaccgctttg      2940
     actgtttcat tgtgtgtggg ggcatcctgg agaccatcct ggtggagacg aagatcatgt      3000
     ctcccctggg catctctgtg ctgagatgtg tgcggttgct caggatcttc aagatcacca      3060
     ggtactggaa ttccttgagc aaccttgtgg catccttgct gaactcagtg cgctccattg      3120
     cctccctgct gctgctcctc ttcctcttca tcatcatctt ctccctcctg gggatgcagc      3180
     tctttggagg gaagttcaat ttcgatgaga tgcagacccg taggagcacg ttcgataact      3240
     tcccgcagtc tctcctcact gtgtttcaga tcctgaccgg ggaggactgg aattcggtga      3300
     tgtatgatgg gatcatggct tatggcggcc cctcttttcc agggatgtta gtctgtattt      3360
     acttcatcat cctcttcatc tgtggaaatt atatcctact gaatgtgttc ttggccattg      3420
     cggtggacaa cctggctgat gcggagagcc tgacctcagc ccaaaaggag gaggaagaag      3480
     agaaggagag gaagaagctg gccaggactg ccagcccaga aaagaaacag gaggtgatgg      3540
     agaagccagc cgtggaggag agcaaagagg agaaaattga actgaaatcc attacagccg      3600
     atggagaatc cccacccact accaagatca acatggatga cctccagccc agtgaaaacg      3660
     aggataagag tccccactcc aacccagaca ctgcagggga agaggatgaa gaggagccag      3720
     agatgcctgt ggggccacgc ccccggcccc tgtctgagct gcaccttaag gaaaaggcag      3780
     ttcccatgcc ggaagccagt gcatttttca tcttcagccc aaacaacagg ttccgcctgc      3840
     agtgccaccg tattgtcaat gacacgatct tcaccaacct catcctcttc ttcattctgc      3900
     tcagcagcat ctctctggct gctgaggacc ccgtccagca cacctccttc aggaaccata      3960
     tcctaggcaa tgcagactat gtcttcacta gtatctttac attagaaatt atccttaaga      4020
     tgactgctta cggggctttc ctgcacaagg gctctttctg ccgaaactac ttcaatatcc      4080
     tggacctgct ggtggttagc gtgtccctca tctcctttgg catccagtcc agcgcgatca      4140
     acgttgtgaa gattttacga gtgctgcgag tcctcagacc cctgagggcc atcaacaggg      4200
     ccaaggggct aaagcatgtg gttcagtgcg tgtttgtggc catccggacc atcgggaaca      4260
     tcgtaattgt caccactctg ctgcagttca tgttcgcctg cattggggtc cagctcttca      4320
     agggaaagct ctatacctgt tcggatagtt ctaaacagac ggaggcagaa tgcaagggta      4380
     actatatcac atacaaagat ggagaggtcg atcaccccat tatccagcct cgaagctggg      4440
     agaacagcaa gtttgacttt gacaatgttt tggcagccat gatggctctc ttcaccgtct      4500
     ccaccttcga agggtggcca gagctgctgt accgctccat tgactcccac acagaagaca      4560
     agggccccat ctacaactac cgtgtggaga tctccatctt cttcatcatc tatatcatca      4620
     tcattgcctt cttcatgatg aacatcttcg tgggtttcgt cattgtcacc ttccaggagc      4680
     agggggaaca agagtacaag aactgtgagc tggacaagaa ccagagacaa tgtgtggaat      4740
     atgccctcaa ggcccgaccc ttgcgaaggt acatccccaa gaaccagcac cagtacaaag      4800
     tgtggtacgt ggtcaactct acctacttcg agtatctgat gttcgttctc atcctgctca      4860
     acaccatctg cctggccatg cagcactatg gccagagctg cctcttcaaa atcgccatga      4920
     atatactcaa catgcttttc accggcctct tcacagtgga gatgatcctg aagctcattg      4980
     ccttcaaacc caagggttac tttagtgatc cctggaatgt ttttgacttc ctcatcgtca      5040
     ttgggagcat aattgatgtc attctcagtg agactaatcc agctgaacat acccaatgct      5100
     ctccctctat gagtgcagag gagaactccc gcatctccat caccttcttc cgcctcttcc      5160
     gggtcatgcg cctggtgaag ctgctgagcc gcggggaagg catccgaacc ctgctgtgga      5220
     ccttcatcaa gtccttccag gctctgccct atgtggctct tttgattgtg atgctgttct      5280
     ttatctatgc agtgattggg atgcaggtgt ttgggaagat tgccctgaat gacaccacag      5340
     agatcaatcg gaacaacaac ttccagacgt tcccccaggc tgtgttactg ctgttcaggt      5400
     gtgccaccgg agaggcctgg caggacatca tgctggcctg catgccaggc aagaagtgtg      5460
     ccccagagtc tgagcccagc aacagcacgg aaggggagac cccctgtggc agcagctttg      5520
     ctgtcttcta cttcatcagc ttctacatgc tctgtgcctt cctgatcatc aacctctttg      5580
     tagctgttat catggacaac tttgactacc tgactaggga ttggtctatc ctcggtcccc      5640
     atcacctgga tgaattcaag agaatctggg ccgagtatga ccctgaagcc aagggtcgga      5700
     tcaaacactt ggatgtggtg accctcctcc gtcgaattca gcccccactg ggttttggga      5760
     aattgtgtcc tcaccgtgtg gcctgcaaac gcctggtgtc catgaacatg cctctgaaca      5820
     gcgatggcac agtcatgttc aatgctaccc tgtttgccct cgtcaggaca gccctgagga      5880
     tcaaaacaga agggaaccta gagcaagcca atgaggagct tcgggccatc atcaagaaaa      5940
     tctggaagag gactagcatg aagctgttgg accaggtggt gccccctgca ggcgatgacg      6000
     aggtcacagt gggcaagttc tatgccacct tcctgatcca agagtacttc aggaaattca      6060
     agaagcgaaa agagcagggg ctggtgggca agccctcaca aaggaatgca ctgtccctcc      6120
     aggctggctt gcgcaccttg catgacattg ggcctgagat ccggcgggcc atctctgggg      6180
     atctgactgc tgaggaggag ttggacaagg ctatgaagga ggcggtgtct gctgcctccg      6240
     aagatgacat cttcaggagg gctggaggcc tgttcggcaa ccatgtcacc tactatcaga      6300
     gtgacagcag gggcaacttt cctcagacgt tcgccaccca gcgcccactg cacatcaaca      6360
     agacagggaa caaccaagct gacactgagt caccgtccca tgagaagctg gtggactcca      6420
     cgttcacccc cagcagctac tcatccacgg gctccaatgc caacatcaac aatgccaaca      6480
     acactgccct gggccgcttc ccccatcccg ctggctactc cagcacggtc agcactgtgg      6540
     agggccatgg gcctcccttg tcccctgctg tccgagtaca ggaggcagca tggaagctca      6600
     gctctaagag gtgccactcc cgagagagcc agggagccac ggtgaatcag gagatatttc      6660
     cagatgagac ccgcagcgta aggatgagtg aagaagccga gtactgcagt gagcccagcc      6720
     tgctctccac agatatgttc tcctaccagg aagatgaaca ccgacaactg acctgcccag      6780
     aggaggacaa gagggagatc cagccatctc caaagaggag tttccttcgc tctgcctctc      6840
     taggtcgaag ggcctccttc catctggaat gtctaaagcg acaaaaggat caagggggag      6900
     acatctctca gaagacagcc ttgcccttgc atctggttca tcatcaggca ttggcagtgg      6960
     caggcttgag ccccctcctg cagagaagcc attctcctac cacattcccc aggccgtgcc      7020
     ccacaccccc tgtcactcca ggcagccggg gcagacccct acggcccatc cctaccctac      7080
     ggctggaggg ggcagagtcc agcgagaaac tcaacagcag cttcccatcc atccactgca      7140
     gctcctggtc tgaggagacg acagcctgta gtgggagcag cagcatggcc cggagagccc      7200
     ggcccgtctc cctcaccgtg cccagccagg ctggagctcc agggagacag ttccatggca      7260
     gtgccagcag cctggtggaa gcggtcttga tttcagaagg actgggacag tttgctcaag      7320
     atcccaagtt catcgaggtc accacccagg agctggctga cgcctgcgac atgacaatag      7380
     aggagatgga gaacgccgca gacaacatcc tcagtggggg cgcccagcag agccccaacg      7440
     gcaccctctt accttttgtg aactgcaggg acccggggca ggacagggct gtggccccag      7500
     aggacgagag ctgcgcatat gccctggggc gaggccggag cgaggaggcg ctcgcggaca      7560
     gcaggtccta cgtcagcaac ctgtagtcct cagggctggc gagacgcggg tggttttttt      7620
     attcgtttca atgttcctaa tgggttcgtt tcagaagtgc ctcactgttc tcgtgacctg      7680
     gaggtaaccg gaacagcgtc ttcattcact gctgtcggga taagcctcag agctgggcgg      7740
     tgtacggagt cggcttttca ggggagaagg ccaaggccgt ggtgcggggg ctccagcacc      7800
     ttccgcggca gcaccgccca aaggacccca cccccacccc tgagcaaaag ggtgttttcc      7860
     ccttgcttgt ataaacagtc atttgcacat gttctgtctg agcctggccg tctctatgga      7920
     gcagggcccc agggatctat ggcaggaatg ggccagcgcc cccagtagga gccgggaggt      7980
     ggctgcgagg ttcccagcag tgcaggtctg gtccctatgg tcccttcagg gactctttcc      8040
     ctgcaaggag ctgagatgca ggtggcagga gccagtgcag atcacaccac ccgccctcag      8100
     ctagccaggc caggggggcg caggctgctg cctggtgctc ggggtttcat ggtttgaggg      8160
     ttcttgtcag catgttgcga ctttctgggg tttggtttct ttattactat ttgttgtgtt      8220
     ttcccacggg gaggggagga ataagagcgg ttacaactgc gcggcctcac ttcactgttt      8280
     ccacatttgc atttgcgtat ttaagtcgga tttggtttga ttgtattctt taaatggtgc      8340
     ggtccacccc caccgccacc cccacccccc actggagcaa gggttcaata tcaccagaga      8400
     aaggttttac ctgctctgtg tctgcccagt aacttgttcc aatttcctta agtaaaagca      8460
     acttttttct ttctttcgag tttggttgag catcacaatc agcaggctaa caggcagtta      8520
     gatcaggcgg tgtgcgcctg ggcgattgag ctgggctcct ttctgtgctg ggcatatgga      8580
     ctggttcaag agagaagaaa tatgggcatc tttgtgtcac acttgtgtcc atagtatgtg      8640
     cgtatgtgca cccacgtggt atgtgtgcgc cccaccccac ccctgcacaa aagcctgtag      8700
     aaccccgttt gggtttgact gcagggagtt ctaaatctgg ggctatttga aagcaagaac      8760
     aaaccactgt ctctgcttct gcttctgaaa cgagaatcgg taactgcatt tttctgtccc      8820
     acgagatatg caaaagcaat gcaataatat ccattttaaa atatggttgt gagttgtgtc      8880
     agcattaaaa ttctatttta aaaaaaaaac cacgaaattt aagggaaaaa ctcaagaaga      8940
     cattttgctt cgatatattc tgtgtaatgt tttattgcat tgataatgtt tctgttgaag      9000
     aaactgttat actt                                                        9014
//


spacer
spacer