Dbfetch

ID   L01695; SV 1; linear; mRNA; STD; MUS; 2986 BP.
XX
AC   L01695;
XX
DT   30-SEP-1992 (Rel. 33, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Mus musculus calmodulin-dependent phosphodiesterase (PDE1B1) mRNA, complete
DE   cds.
XX
KW   calmodulin-dependent phosphodiesterase.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2986
RX   DOI; 10.1073/pnas.89.22.11079.
RX   PUBMED; 1332068.
RA   Polli J.W., Kincaid R.L.;
RT   "Molecular cloning of DNA encoding a calmodulin-dependent phosphodiesterase
RT   enriched in striatum";
RL   Proc. Natl. Acad. Sci. U.S.A. 89(22):11079-11083(1992).
XX
DR   MD5; 4a1edac1da4bcdb9a615a7d84cc31dda.
DR   Ensembl-Gn; ENSMUSG00000022489; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022444; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0022406; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0022381; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022410; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022177; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022859; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021703; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0022146; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0022277; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0022253; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0022346; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022275; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022871; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021443; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021753; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000023132; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042878; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0042843; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0042809; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042832; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042567; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0043315; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042667; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0042479; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0042635; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0042595; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0042706; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042578; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0043355; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0042251; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041955; mus_musculus_wsbeij.
DR   EuropePMC; PMC23052; 10535984.
DR   EuropePMC; PMC26687; 10618442.
DR   EuropePMC; PMC50487; 1332068.
DR   EuropePMC; PMC508463; 9366577.
DR   EuropePMC; PMC87143; 11416145.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2986
FT                   /organism="Mus musculus"
FT                   /sub_species="domesticus"
FT                   /strain="BALB/c"
FT                   /mol_type="mRNA"
FT                   /dev_stage="20-day"
FT                   /tissue_lib="Stratagene Corp. #937301 in Uni-ZAP XR"
FT                   /tissue_type="whole brain"
FT                   /db_xref="taxon:10090"
FT   5'UTR           1..95
FT   CDS             96..1703
FT                   /codon_start=1
FT                   /standard_name="PDE1B1"
FT                   /product="calmodulin-dependent phosphodiesterase"
FT                   /db_xref="GOA:Q01065"
FT                   /db_xref="InterPro:IPR002073"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR013706"
FT                   /db_xref="InterPro:IPR023088"
FT                   /db_xref="InterPro:IPR023174"
FT                   /db_xref="MGI:MGI:97523"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q01065"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="AAA39902.1"
FT                   /translation="MELSPRSPPEMLESDCPSPLELKSAPSKKMWIKLRSLLRYMVKQL
FT                   ENGEVNIEELKKNLEYTASLLEAVYIDETRQILDTEDELRELRSDAVPSEVRDWLASTF
FT                   TQQTRAKGRRAEEKPKFRSIVHAVQAGIFVERMFRRTYTSVGPTYSTAVHNCLKNLDLW
FT                   CFDVFSLNRAADDHALRTIVFELLTRHSLISRFKIPTVFLMSFLEALETGYGKYKNPYH
FT                   NQIHAADVTQTVHCFLLRTGMVHCLSEIEVLAIIFAAAIHDYEHTGTTNSFHIQTKSEC
FT                   AILYNDRSVLENHHISSVFRMMQDDEMNIFINLTKDEFAELRALVIEMVLATDMSCHFQ
FT                   QVKTMKTALQQLERIDKSKALSLLLHAADISHPTKQWSVHSRWTKALMEEFFRQGDKEA
FT                   ELGLPFSPLCDRTSTLVAQSQIGFIDFIVEPTFSVLTDVAEKSVQPLADDDSKPKSQPS
FT                   FQWRQPSLDVDVGDPNPDVVSFRATWTKYIQENKQKWKERAASGITNQMSIDELSPCEE
FT                   EAPSSPAEDEHNQNGNLD"
FT   3'UTR           1704..2986
FT   regulatory      2942..2947
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 2986 BP; 695 A; 831 C; 786 G; 674 T; 0 other;
     gcacgaggcc gcaggaactg cagccctgct agcttgggcc gagcagaaac acaccggcct        60
     ggctggtcca cgccagccgc agacagtggc tgagcatgga gctgtccccc cgcagtcctc       120
     cagagatgct ggagtcggat tgcccgtcac ccctggagct gaagtcagcc cccagcaaga       180
     aaatgtggat taagctacgg tctctgctgc gctacatggt gaagcagttg gagaatgggg       240
     aggttaacat cgaggagctg aagaaaaacc tggaatacac agcttccctg ctggaagctg       300
     tctacattga tgagacaagg caaatcctag acactgaaga tgagcttcgg gaacttcggt       360
     cagatgctgt gccttcagag gtgcgggact ggttggcctc caccttcacc cagcagaccc       420
     gagccaaagg tcgcagggca gaagagaaac ccaagttccg aagcatcgtg catgctgtgc       480
     aggctgggat cttcgtggag cggatgttcc ggagaacgta tacctctgtg ggccccacat       540
     actctactgc agtccacaac tgtctcaaga acctggacct ctggtgcttt gatgtctttt       600
     ccttgaaccg ggcagccgat gaccacgctc tgaggaccat tgtttttgag ttgctgactc       660
     ggcatagcct catcagccgc tttaagattc ccacagtgtt tctgatgagt tttctggagg       720
     ccttggagac aggctatggg aaatataaga atccttacca caaccagatc cacgcagccg       780
     acgtgaccca gactgtccat tgcttccttc tccgcacagg catggtgcac tgcctgtcag       840
     agattgaggt cttggccatc atctttgctg cagccatcca tgactatgag cacacaggca       900
     caaccaacag cttccacatt cagaccaagt cagaatgtgc catcctgtac aatgatcgat       960
     cggtgctgga gaatcaccac atcagctctg tctttcgaat gatgcaggat gatgagatga      1020
     acatttttat caatctcacc aaggatgaat ttgcagagct gcgggccctg gttatcgaga      1080
     tggtgttggc cacagacatg tcctgccatt tccagcaagt gaagactatg aagacagcac      1140
     tgcagcagtt ggaaaggatt gacaagtcca aggccctatc tcttctgctt catgctgctg      1200
     acatcagcca cccaactaag cagtggtcag tccacagccg ctggaccaag gccctaatgg      1260
     aagagttctt ccgccagggt gacaaggagg cagagctggg cctgcccttc tctccactct      1320
     gtgatcgcac ttccacattg gtggcccagt cccagatagg tttcattgac ttcattgtgg      1380
     agccaacctt ctctgtgctg actgatgtgg cagaaaagag tgtccagccc ttggcagatg      1440
     atgattccaa gcctaaaagt cagcccagct tccagtggcg ccagccttct ttagatgtgg      1500
     acgtaggaga ccccaaccct gatgtggtca gtttccgtgc cacctggacc aagtacattc      1560
     aagagaacaa acagaagtgg aaggaacggg cagcaagtgg catcaccaac cagatgtcca      1620
     ttgatgaact gtccccctgt gaggaagaag ccccatcctc ccctgcagaa gatgagcaca      1680
     accagaatgg gaatctggat tagggaactg ggggctgacc aggtcctcac tgagtccaaa      1740
     gtcttcgatg tcattagcac tatccatcag gactggttcc cccatctgct ccaagggagt      1800
     gtgttggttg tgggagagac agctcacctg agagccaaat gttggagcgg gtggggtgtg      1860
     ggaagggccc ctccccaccc acaggccctc agtggtcact gtgcccatcc cttgcctctg      1920
     gactcctcct ttggccactt gggaggagta agctccctgc aggcttccta cagtttggag      1980
     gggagggtca gagatgccag ccccctgggc cctccccatc cttcttgcct ccaagtttct      2040
     aagcaataca ttttgggggt tccctcagtc ccccacccca gatcttagct ggcaggtctg      2100
     ggtttccctt ctcttccctg agaaagggcc agaataggat aggaagctgg cagttttcaa      2160
     agccctgcat gggaagggca ggtgtccctt caggttcctt cctaagatga ggtgggggac      2220
     atcctcttga tcccatactt gcacttcttc agccccattc ccttgcaaat tctctctctc      2280
     ctgtgcccag acagtggctg ggagaggaga ggagccattg ggattctgtc tgagggaagt      2340
     ctttcctgga gtcctcaaat acttggggat ggtctgggct tgaggggctt gtaccctgat      2400
     ctagatgggt ttttgaccct ttgcctcctt cctgtccccg ggaactagga agccctcatc      2460
     cgaccaatgt ctgtaaacgc tctgaggtct tccttcagga tgtatcttat gagcaaagga      2520
     aggagagagc agctagcccc agtacaagca gggggaagta ttacccagta atgttgacac      2580
     agagcaggtc cttcctgcct cccttctccc cgaactggcc cactaagaga tttccccctc      2640
     ccggggcccc tggtgggtgg aaggcagatg gggaggggct cagggcggta gcaacttgga      2700
     gcacccagag cgagtgcagc caggtaaagc ctcttcctgt cctcaggctc cttgccccac      2760
     gtcaccccat ttaaggccaa gtccaggtga ctgcctcctc ctctcttgta aatacatgca      2820
     tttgtacagt gggccctgtt cttgtgaagt ccatctccat ggtcattaga cctgccactc      2880
     tgaaccgcat gtgactcccc catgctcttg gtctcccagg cccctgctat agccagagat      2940
     caataaagaa gggagaccgg caaaaaaaaa aaaaaaaaaa aaaaaa                     2986
//