spacer

EBI Dbfetch

ID   L00619; SV 1; linear; mRNA; STD; MUS; 4294 BP.
XX
AC   L00619;
XX
DT   25-DEC-1992 (Rel. 34, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mouse T-cell-specific tyrosine kinase (Itk) mRNA, complete cds.
XX
KW   interleukin induced gene; T-cell specific tyrosine kinase.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4294
RX   DOI; 10.1073/pnas.89.23.11194.
RX   PUBMED; 1280821.
RA   Siliciano J.D., Morrow T.A., Desiderio S.V.;
RT   "itk, a T-cell-specific tyrosine kinase gene inducible by interleukin 2";
RL   Proc. Natl. Acad. Sci. U.S.A. 89(23):11194-11198(1992).
XX
DR   MD5; 1a2cf0d0bd8f2496071a5bb3ac1cc4fe.
DR   Ensembl-Gn; ENSMUSG00000020395; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109237; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4294
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   5'UTR           10..92
FT                   /gene="Itk"
FT   CDS             93..1970
FT                   /codon_start=1
FT                   /gene="Itk"
FT                   /product="T-cell-specific tyrosine kinase"
FT                   /note="interleukin-2 inducible"
FT                   /db_xref="GOA:Q03526"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000980"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001562"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="MGI:MGI:96621"
FT                   /db_xref="PDB:1AWJ"
FT                   /db_xref="PDB:1LUI"
FT                   /db_xref="PDB:1LUK"
FT                   /db_xref="PDB:1LUM"
FT                   /db_xref="PDB:1LUN"
FT                   /db_xref="PDB:2ETZ"
FT                   /db_xref="PDB:2EU0"
FT                   /db_xref="PDB:2K79"
FT                   /db_xref="PDB:2K7A"
FT                   /db_xref="PDB:2RN8"
FT                   /db_xref="PDB:2RNA"
FT                   /db_xref="PDB:3S9K"
FT                   /protein_id="AAA39337.1"
FT                   /translation="MNNFILLEEQLIKKSQQKRRTSPSNFKVRFFVLTKASLAYFEDRH
FT                   GKKRTLKGSIELSRIKCVEIVKSDISIPCHYKYPFQTLVYLQVVHDNYLLYVFAPDCES
FT                   RQRWVLTLKEETRNNNSLVSKYHPNFWMDGRWRCCSQLEKPAVGCAPYDPSKNASKKPL
FT                   PPTPEDNRRSFQEPEETLVIALYDYQTNDPQELALRCDEEYYLLDSSEIHWWRVQDKNG
FT                   HEGYAPSSYLVEKSPNNLETYEWYNKSISRDKAEKLLLDTGKEGAFMVRDSRTPGTYTV
FT                   SVFTKAIISENPCIKHYHIKETNDSPKRYYVAEKYVFDSIPLLIQYHQYNGGGLVTRLR
FT                   YPVCSWRQKAPVTAGLRYGKWVIQPSELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIQ
FT                   EGAMSEEDFIEEAEVMMKLSHPKLVQLYGVCLEQAPICLVFEFMEHGCLSDYLRSQRGL
FT                   FAAETLLGMCLDVCEGMAYLEKACVIHRDLAARNCLVGENQVIKVSDFGMTRFVLDDQY
FT                   TSSTGTKFPVKWASPEVFSFSRYSSKSDVWSFGVLMWEVFSEGKIPYENRSNSEVVEDI
FT                   STGFRLYKPRLASCHVYQIMNHCWKEKPEDRPPFSQLLSQLAEIAEAGL"
FT   3'UTR           1971..4265
FT                   /gene="Itk"
XX
SQ   Sequence 4294 BP; 1128 A; 1071 C; 1044 G; 1051 T; 0 other;
     gaattccgtt cctgtctcag tctccgctgc tcctctcctt cagtcgcact gcggggtgat        60
     gcccaaggcg catcactttt cagaactgga ccatgaacaa cttcatcctc ctggaagaac       120
     agctgatcaa gaagtcccaa cagaagagaa ggacttctcc ctcgaatttt aaagttcgtt       180
     tctttgtctt aacgaaagcc agcctggcct actttgagga ccgccacggg aagaagcgca       240
     cgttgaaggg ctccattgaa ctctccagaa tcaagtgtgt ggagattgtc aagagtgaca       300
     ttagcatccc gtgccactat aaataccctt ttcagactct tgtgtactta caggtcgtgc       360
     atgacaacta tctcctgtat gtgtttgctc cagactgtga gagtcggcag cgctgggtgc       420
     tgacccttaa agaagaaacg aggaataaca acagcctggt atccaagtat caccctaatt       480
     tctggatgga tgggcggtgg aggtgctgct cccagctgga gaagcctgct gtaggctgtg       540
     ctccctacga cccatccaag aatgcttcaa agaagcctct tcctcctact cctgaagaca       600
     acaggcggtc atttcaggaa cctgaagaaa ccctggtcat tgccttgtac gactaccaaa       660
     ccaacgaccc tcaggagctc gcgctgcggt gtgatgaaga gtactacctg ctggacagct       720
     ccgagatcca ctggtggagg gttcaagaca aaaatgggca tgaaggatat gcaccaagca       780
     gttacctggt agaaaaatct ccaaataacc ttgaaaccta tgagtggtac aataaaagca       840
     tcagccgcga caaagctgaa aaacttcttt tggacacagg taaagaagga gctttcatgg       900
     tccgagattc caggacgccc gggacataca cagtctctgt tttcaccaag gccatcataa       960
     gtgagaaccc ctgtataaaa cattatcaca tcaaagaaac aaatgacagc cccaagcgct      1020
     actacgtggc tgagaagtat gtgtttgact ccatccctct cctcatccag tatcaccagt      1080
     acaatggagg aggtttggtc actcgactcc gctatccagt ttgctcctgg agacaaaaag      1140
     cccctgtcac agcagggcta agatatggga agtgggtgat ccaaccctca gagctaacgt      1200
     tcgtgcagga gattggcagc gggcagtttg ggctggtgca tctcggctac tggctcaaca      1260
     aggacaaggt ggccatcaag accattcagg aaggggcgat gtcagaagaa gactttatcg      1320
     aggaggcgga agtcatgatg aaactctctc accccaaact ggtgcagctc tatggggtgt      1380
     gcctggagca agcccccatc tgcctggtgt ttgagttcat ggagcacggc tgcctgtcgg      1440
     attaccttcg aagtcagcgg ggtctctttg ctgcggagac cctgctgggc atgtgcctgg      1500
     atgtgtgtga gggcatggcc tacctggaaa aagcttgtgt catccacaga gacctggcag      1560
     ccagaaactg tttggtggga gaaaaccagg tcatcaaggt gtccgacttt gggatgacaa      1620
     gatttgtcct tgatgatcaa tataccagct ccacgggcac caaattccca gtgaagtggg      1680
     catccccaga ggtgttctcc tttagtcgct atagcagcaa gtcagatgtg tggtcgtttg      1740
     gtgtactgat gtgggaagtc ttcagtgaag gcaaaatccc atacgaaaac cgaagcaatt      1800
     ccgaggtcgt ggaagatatc agcactggct ttcggttata caagccccgc ctggcctcct      1860
     gtcatgtcta ccagatcatg aatcattgct ggaaagagaa accagaagac cggccaccct      1920
     tctcccagct gttaagccag ctggctgaaa tcgcagaagc tgggctttag cagggactca      1980
     ttgaccagac acagccataa atcctgagtg aaggaacaat gtcctttttc cagagcatta      2040
     aaagctgcca ccagtccaga aacccccaca ggtgcctgga ccatggtgcc agcacctatg      2100
     cagccacaac tgcagcatca tagaaaaggg tggagggcca gccactgagc caacagctga      2160
     accacaactg gagcagtatc tgcgtgtcac cccatcccag cctcttgtcg tatgctgtac      2220
     tcaaagctcc attgcccact ctgggagcat cccctccccc tcttagcaat ccatggagag      2280
     gcagacgtag gccacactct tctttattat tactttaaga ataattcaag taacctttaa      2340
     tttggcccaa cgagacaatg tgcccatttt atggatggaa gagcgggaaa gcatcattct      2400
     ttttctaaga aatgcaagag gtgattaaac cagggtgttc tactacttca aggctgtcag      2460
     ccacagcttc ctgcctcaca tgaggcggag cggatgcttg tgccagaggc cggatgccat      2520
     aaggtttcag agcacactgc cacctctctt tgatggggca cagagagctc caccgggtgg      2580
     atagggcagg gtgacacatt cagaccccac ggcaggacca caggatgtct gaggtcggtc      2640
     aggaatgaga gggcctctga tggtggaagt aaagagctgc aaaagaagcc tttgggttgt      2700
     ccctgaccca gcggccctgt ttcacggtga gtcatgtgtg tgactggatc tcctgttctg      2760
     tgcaggatgc tgaagcagtg actacagaac ggtcatcatt ccagcctctc aggagcggca      2820
     tccactcagc actgtcatga tccttgtgac tttgagactt tgggttcttt caagccttta      2880
     cgggttcagc agtcttaagg ttgccatgta agctctcaag agcccagcaa aggaagaagg      2940
     cgtttgctct tgcccaaact atcaggaagg aaagaggcaa gcactgggcg gtgcttccaa      3000
     aatgcacaga tgtctcctac tgattggcac tcgcacaggt gacatgtgta tatcctgcac      3060
     acaggtcatc ctggcgaatc acagttcata ccaacccaac cacgaggtat tattcatgtc      3120
     ttacagaaag tggacttggt cttttaaaag ctggatagct gccccagtga cagaactggg      3180
     aaggacggag attgagatga cacccgaata taactccagt gtagcctctt agctcttctc      3240
     aatgctgcct cctactgggt tgggccgctg agcgcataac acaggaaagt ctgggttaat      3300
     gggcacccca ccccacagcc aagttgctcc tactcagagc actggggggc ccagtgggac      3360
     cctccaaatt gaaataggct gttctctttc ttcaccctca cctggatctg agttcacaac      3420
     cctggagcca ctcaaaatta accctttcat tctcccaacc taccagagtc acattgcctg      3480
     aggccattta tactagagct tcaaaggtgc tttcaactag tctcctgcag actgtttcct      3540
     gtaattatcc cttcaaccta gagctggctc tcttgtgaga aggaggattc cctggtgcca      3600
     ggcacactgg attttctgcg gtgttcagac aaagccccta gaaaaatgat cagagtcaca      3660
     gatccctctt cctaagtcac gtggcattta ggctggcttg aggctcaaat gcatcacttc      3720
     caactgtaat cactgtgtcc agataaaact ctgtcattca gaaaatgaac ttcctcaact      3780
     ggtccacaat catctctgtt tattctcttt tgggaaacct taattaagag acgatttctg      3840
     ggacatccaa tctggaagat aaacactgga accgagagaa gtctgtggtg tggtttagga      3900
     gactggcccc catacggtgg tattggctct cttaacctca catgcacgaa ggctttgatg      3960
     gacgcgtgtg cactgcttac tccagtgtcc tgcttgggaa gatgggattc tcttctgctg      4020
     gtttctgtct tacatttttt tgtaaatggt gccctgtgtt cacagaaagg ttttggtttg      4080
     aaatgtattt tgtaggcctt gcaattcata atgtttggaa ctatgtattt atgcctagat      4140
     caggagagta tttattgctt gtcttcatga taaaaaatac tgcaggtatg tcttaccctc      4200
     tgtgggggcc acaagtcaat cattgcttat ggaaaaaaat atatatataa agctacatgt      4260
     tttacaaaaa aaaaaaaaaa aaaaaaagga attc                                  4294
//


spacer
spacer