spacer

EBI Dbfetch

ID   JN709868; SV 1; linear; mRNA; STD; HUM; 3022 BP.
XX
AC   JN709868;
XX
DT   13-FEB-2012 (Rel. 111, Created)
DT   13-FEB-2012 (Rel. 111, Last updated, Version 1)
XX
DE   Homo sapiens alpha-synuclein transcript variant 14 (SNCA) mRNA, complete
DE   cds, alternatively spliced.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3022
RA   Beyer K., Munoz-Marmol A.M.;
RT   "SNCA transcript variants can be classified into four groups in dependence
RT   on their initial exon";
RL   Unpublished.
XX
RN   [2]
RP   1-3022
RA   Beyer K., Munoz-Marmol A.M.;
RT   ;
RL   Submitted (22-SEP-2011) to the INSDC.
RL   Department of Pathology, University Hospital Germans Trias i Pujol,
RL   Carretera de Canyet s/n, Badalona, Barcelona 08916, Spain
XX
DR   MD5; b91df9c2a3ffc2dc6100b32989402972.
DR   Ensembl-Gn; ENSG00000145335; homo_sapiens.
DR   Ensembl-Tr; ENST00000394989; homo_sapiens.
DR   Ensembl-Tr; ENST00000505199; homo_sapiens.
DR   Ensembl-Tr; ENST00000618500; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3022
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:9606"
FT   gene            1..3022
FT                   /gene="SNCA"
FT   exon            1..87
FT                   /gene="SNCA"
FT                   /number=2c
FT   exon            88..233
FT                   /gene="SNCA"
FT                   /number=3
FT   CDS             113..493
FT                   /codon_start=1
FT                   /gene="SNCA"
FT                   /product="alpha-synuclein transcript variant 14"
FT                   /note="alternatively spliced"
FT                   /db_xref="GOA:H6UYS0"
FT                   /db_xref="InterPro:IPR001058"
FT                   /db_xref="InterPro:IPR002460"
FT                   /db_xref="UniProtKB/TrEMBL:H6UYS0"
FT                   /protein_id="AFA25678.1"
FT                   /translation="MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVVAEKT
FT                   KEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPV
FT                   DPDNEAYEMPSEEGYQDYEPEA"
FT   exon            234..376
FT                   /gene="SNCA"
FT                   /number=5
FT   exon            377..460
FT                   /gene="SNCA"
FT                   /number=6
FT   exon            461..3022
FT                   /gene="SNCA"
FT                   /number=7
FT   regulatory      755..760
FT                   /gene="SNCA"
FT                   /regulatory_class="polyA_signal_sequence"
FT   regulatory      1036..1041
FT                   /gene="SNCA"
FT                   /regulatory_class="polyA_signal_sequence"
FT   regulatory      1041..1046
FT                   /gene="SNCA"
FT                   /regulatory_class="polyA_signal_sequence"
FT   regulatory      2997..3002
FT                   /gene="SNCA"
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 3022 BP; 932 A; 486 C; 608 G; 996 T; 0 other;
     gatagctgag ggcgggggtg gatgttggat ggattagaac catcacactt gggcctgctg        60
     tttgcctgag tttgaaccac accccgatgt ggtgtaaagg aattcattag ccatggatgt       120
     attcatgaaa ggactttcaa aggccaagga gggagttgtg gctgctgctg agaaaaccaa       180
     acagggtgtg gcagaagcag caggaaagac aaaagagggt gttctctatg tagtggctga       240
     gaagaccaaa gagcaagtga caaatgttgg aggagcagtg gtgacgggtg tgacagcagt       300
     agcccagaag acagtggagg gagcagggag cattgcagca gccactggct ttgtcaaaaa       360
     ggaccagttg ggcaagaatg aagaaggagc cccacaggaa ggaattctgg aagatatgcc       420
     tgtggatcct gacaatgagg cttatgaaat gccttctgag gaagggtatc aagactacga       480
     acctgaagcc taagaaatat ctttgctccc agtttcttga gatctgctga cagatgttcc       540
     atcctgtaca agtgctcagt tccaatgtgc ccagtcatga catttctcaa agtttttaca       600
     gtgtatctcg aagtcttcca tcagcagtga ttgaagtatc tgtacctgcc cccactcagc       660
     atttcggtgc ttccctttca ctgaagtgaa tacatggtag cagggtcttt gtgtgctgtg       720
     gattttgtgg cttcaatcta cgatgttaaa acaaattaaa aacacctaag tgactaccac       780
     ttatttctaa atcctcacta tttttttgtt gctgttgttc agaagttgtt agtgatttgc       840
     tatcatatat tataagattt ttaggtgtct tttaatgata ctgtctaaga ataatgacgt       900
     attgtgaaat ttgttaatat atataatact taaaaatatg tgagcatgaa actatgcacc       960
     tataaatact aaatatgaaa ttttaccatt ttgcgatgtg ttttattcac ttgtgtttgt      1020
     atataaatgg tgagaattaa aataaaacgt tatctcattg caaaaatatt ttatttttat      1080
     cccatctcac tttaataata aaaatcatgc ttataagcaa catgaattaa gaactgacac      1140
     aaaggacaaa aatataaagt tattaatagc catttgaaga aggaggaatt ttagaagagg      1200
     tagagaaaat ggaacattaa ccctacactc ggaattccct gaagcaacac tgccagaagt      1260
     gtgttttggt atgcactggt tccttaagtg gctgtgatta attattgaaa gtggggtgtt      1320
     gaagacccca actactattg tagagtggtc tatttctccc ttcaatcctg tcaatgtttg      1380
     ctttacgtat tttggggaac tgttgtttga tgtgtatgtg tttataattg ttatacattt      1440
     ttaattgagc cttttattaa catatattgt tatttttgtc tcgaaataat tttttagtta      1500
     aaatctattt tgtctgatat tggtgtgaat gctgtacctt tctgacaata aataatattc      1560
     gaccatgaat aaaaaaaaaa aaaaagtggg ttcccgggaa ctaagcagtg tagaagatga      1620
     ttttgactac accctcctta gagagccata agacacatta gcacatatta gcacattcaa      1680
     ggctctgaga gaatgtggtt aactttgttt aactcagcat tcctcacttt ttttttttaa      1740
     tcatcagaaa ttctctctct ctctctctct ttttctctcg ctctcttttt tttttttttt      1800
     ttacaggaaa tgcctttaaa catcgttgga actaccagag tcaccttaaa ggagatcaat      1860
     tctctagact gataaaaatt tcatggcctc ctttaaatgt tgccaaatat atgaattcta      1920
     ggatttttcc ttaggaaagg tttttctctt tcagggaaga tctattaact ccccatgggt      1980
     gctgaaaata aacttgatgg tgaaaaactc tgtataaatt aatttaaaaa ttatttggtt      2040
     tctcttttta attattctgg ggcatagtca tttctaaaag tcactagtag aaagtataat      2100
     ttcaagacag aatattctag acatgctagc agtttatatg tattcatgag taatgtgata      2160
     tatattgggc gctggtgagg aaggaaggag gaatgagtga ctataaggat ggttaccata      2220
     gaaacttcct tttttaccta attgaagaga gactactaca gagtgctaag ctgcatgtgt      2280
     catcttacac tagagagaaa tggtaagttt cttgttttat ttaagttatg tttaagcaag      2340
     gaaaggattt gttattgaac agtatatttc aggaaggtta gaaagtggcg gttaggatat      2400
     attttaaatc tacctaaagc agcatatttt aaaaatttaa aagtattggt attaaattaa      2460
     gaaatagagg acagaactag actgatagca gtgacctaga acaatttgag attaggaaag      2520
     ttgtgaccat gaatttaagg atttatgtgg atacaaattc tcctttaaag tgtttcttcc      2580
     cttaatattt atctgacggt aatttttgag cagtgaatta ctttatatat cttaatagtt      2640
     tatttgggac caaacactta aacaaaaagt tctttaagtc atataagcct tttcaggaag      2700
     cttgtctcat attcactccc gagacattca cctgccaagt ggcctgagga tcaatccagt      2760
     cctaggttta ttttgcagac ttacattctc ccaagttatt cagcctcata tgactccacg      2820
     gtcggcttta ccaaaacagt tcagagtgca ctttggcaca caattgggaa cagaacaatc      2880
     taatgtgtgg tttggtattc caagtggggt ctttttcaga atctctgcac tagtgtgaga      2940
     tgcaaacatg tttcctcatc tttctggctt atccagtatg tagctatttg tgacataata      3000
     aatatataca tatatgaaaa ta                                               3022
//


spacer
spacer