spacer

EBI Dbfetch

ID   JN709865; SV 1; linear; mRNA; STD; HUM; 2980 BP.
XX
AC   JN709865;
XX
DT   13-FEB-2012 (Rel. 111, Created)
DT   13-FEB-2012 (Rel. 111, Last updated, Version 1)
XX
DE   Homo sapiens alpha-synuclein transcript variant 11 (SNCA) mRNA, complete
DE   cds, alternatively spliced.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2980
RA   Beyer K., Munoz-Marmol A.M.;
RT   "SNCA transcript variants can be classified into four groups in dependence
RT   on their initial exon";
RL   Unpublished.
XX
RN   [2]
RP   1-2980
RA   Beyer K., Munoz-Marmol A.M.;
RT   ;
RL   Submitted (22-SEP-2011) to the INSDC.
RL   Department of Pathology, University Hospital Germans Trias i Pujol,
RL   Carretera de Canyet s/n, Badalona, Barcelona 08916, Spain
XX
DR   MD5; 06f50f41d4d04ed128b74615435ee047.
DR   Ensembl-Gn; ENSG00000145335; homo_sapiens.
DR   Ensembl-Tr; ENST00000394989; homo_sapiens.
DR   Ensembl-Tr; ENST00000505199; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2980
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:9606"
FT   gene            1..2980
FT                   /gene="SNCA"
FT   exon            1..45
FT                   /gene="SNCA"
FT                   /number=1
FT   exon            46..191
FT                   /gene="SNCA"
FT                   /number=3
FT   CDS             71..451
FT                   /codon_start=1
FT                   /gene="SNCA"
FT                   /product="alpha-synuclein transcript variant 11"
FT                   /note="alternatively spliced"
FT                   /db_xref="GOA:H6UYS0"
FT                   /db_xref="InterPro:IPR001058"
FT                   /db_xref="InterPro:IPR002460"
FT                   /db_xref="UniProtKB/TrEMBL:H6UYS0"
FT                   /protein_id="AFA25675.1"
FT                   /translation="MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVVAEKT
FT                   KEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPV
FT                   DPDNEAYEMPSEEGYQDYEPEA"
FT   exon            192..334
FT                   /gene="SNCA"
FT                   /number=5
FT   exon            335..418
FT                   /gene="SNCA"
FT                   /number=6
FT   exon            419..2980
FT                   /gene="SNCA"
FT                   /number=7
FT   polyA_signal    713..718
FT                   /gene="SNCA"
FT   polyA_signal    994..999
FT                   /gene="SNCA"
FT   polyA_signal    999..1004
FT                   /gene="SNCA"
FT   polyA_signal    2955..2960
FT                   /gene="SNCA"
XX
SQ   Sequence 2980 BP; 925 A; 477 C; 591 G; 987 T; 0 other;
     attctggtgt gatccaggaa cagctgtctt ccagctctga aagagtgtgg tgtaaaggaa        60
     ttcattagcc atggatgtat tcatgaaagg actttcaaag gccaaggagg gagttgtggc       120
     tgctgctgag aaaaccaaac agggtgtggc agaagcagca ggaaagacaa aagagggtgt       180
     tctctatgta gtggctgaga agaccaaaga gcaagtgaca aatgttggag gagcagtggt       240
     gacgggtgtg acagcagtag cccagaagac agtggaggga gcagggagca ttgcagcagc       300
     cactggcttt gtcaaaaagg accagttggg caagaatgaa gaaggagccc cacaggaagg       360
     aattctggaa gatatgcctg tggatcctga caatgaggct tatgaaatgc cttctgagga       420
     agggtatcaa gactacgaac ctgaagccta agaaatatct ttgctcccag tttcttgaga       480
     tctgctgaca gatgttccat cctgtacaag tgctcagttc caatgtgccc agtcatgaca       540
     tttctcaaag tttttacagt gtatctcgaa gtcttccatc agcagtgatt gaagtatctg       600
     tacctgcccc cactcagcat ttcggtgctt ccctttcact gaagtgaata catggtagca       660
     gggtctttgt gtgctgtgga ttttgtggct tcaatctacg atgttaaaac aaattaaaaa       720
     cacctaagtg actaccactt atttctaaat cctcactatt tttttgttgc tgttgttcag       780
     aagttgttag tgatttgcta tcatatatta taagattttt aggtgtcttt taatgatact       840
     gtctaagaat aatgacgtat tgtgaaattt gttaatatat ataatactta aaaatatgtg       900
     agcatgaaac tatgcaccta taaatactaa atatgaaatt ttaccatttt gcgatgtgtt       960
     ttattcactt gtgtttgtat ataaatggtg agaattaaaa taaaacgtta tctcattgca      1020
     aaaatatttt atttttatcc catctcactt taataataaa aatcatgctt ataagcaaca      1080
     tgaattaaga actgacacaa aggacaaaaa tataaagtta ttaatagcca tttgaagaag      1140
     gaggaatttt agaagaggta gagaaaatgg aacattaacc ctacactcgg aattccctga      1200
     agcaacactg ccagaagtgt gttttggtat gcactggttc cttaagtggc tgtgattaat      1260
     tattgaaagt ggggtgttga agaccccaac tactattgta gagtggtcta tttctccctt      1320
     caatcctgtc aatgtttgct ttacgtattt tggggaactg ttgtttgatg tgtatgtgtt      1380
     tataattgtt atacattttt aattgagcct tttattaaca tatattgtta tttttgtctc      1440
     gaaataattt tttagttaaa atctattttg tctgatattg gtgtgaatgc tgtacctttc      1500
     tgacaataaa taatattcga ccatgaataa aaaaaaaaaa aaagtgggtt cccgggaact      1560
     aagcagtgta gaagatgatt ttgactacac cctccttaga gagccataag acacattagc      1620
     acatattagc acattcaagg ctctgagaga atgtggttaa ctttgtttaa ctcagcattc      1680
     ctcacttttt ttttttaatc atcagaaatt ctctctctct ctctctcttt ttctctcgct      1740
     ctcttttttt tttttttttt acaggaaatg cctttaaaca tcgttggaac taccagagtc      1800
     accttaaagg agatcaattc tctagactga taaaaatttc atggcctcct ttaaatgttg      1860
     ccaaatatat gaattctagg atttttcctt aggaaaggtt tttctctttc agggaagatc      1920
     tattaactcc ccatgggtgc tgaaaataaa cttgatggtg aaaaactctg tataaattaa      1980
     tttaaaaatt atttggtttc tctttttaat tattctgggg catagtcatt tctaaaagtc      2040
     actagtagaa agtataattt caagacagaa tattctagac atgctagcag tttatatgta      2100
     ttcatgagta atgtgatata tattgggcgc tggtgaggaa ggaaggagga atgagtgact      2160
     ataaggatgg ttaccataga aacttccttt tttacctaat tgaagagaga ctactacaga      2220
     gtgctaagct gcatgtgtca tcttacacta gagagaaatg gtaagtttct tgttttattt      2280
     aagttatgtt taagcaagga aaggatttgt tattgaacag tatatttcag gaaggttaga      2340
     aagtggcggt taggatatat tttaaatcta cctaaagcag catattttaa aaatttaaaa      2400
     gtattggtat taaattaaga aatagaggac agaactagac tgatagcagt gacctagaac      2460
     aatttgagat taggaaagtt gtgaccatga atttaaggat ttatgtggat acaaattctc      2520
     ctttaaagtg tttcttccct taatatttat ctgacggtaa tttttgagca gtgaattact      2580
     ttatatatct taatagttta tttgggacca aacacttaaa caaaaagttc tttaagtcat      2640
     ataagccttt tcaggaagct tgtctcatat tcactcccga gacattcacc tgccaagtgg      2700
     cctgaggatc aatccagtcc taggtttatt ttgcagactt acattctccc aagttattca      2760
     gcctcatatg actccacggt cggctttacc aaaacagttc agagtgcact ttggcacaca      2820
     attgggaaca gaacaatcta atgtgtggtt tggtattcca agtggggtct ttttcagaat      2880
     ctctgcacta gtgtgagatg caaacatgtt tcctcatctt tctggcttat ccagtatgta      2940
     gctatttgtg acataataaa tatatacata tatgaaaata                            2980
//


spacer
spacer