spacer

EBI Dbfetch

ID   JN709864; SV 1; linear; mRNA; STD; HUM; 2938 BP.
XX
AC   JN709864;
XX
DT   13-FEB-2012 (Rel. 111, Created)
DT   13-FEB-2012 (Rel. 111, Last updated, Version 1)
XX
DE   Homo sapiens alpha-synuclein transcript variant 10 (SNCA) mRNA, complete
DE   cds, alternatively spliced.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2938
RA   Beyer K., Munoz-Marmol A.M.;
RT   "SNCA transcript variants can be classified into four groups in dependence
RT   on their initial exon";
RL   Unpublished.
XX
RN   [2]
RP   1-2938
RA   Beyer K., Munoz-Marmol A.M.;
RT   ;
RL   Submitted (22-SEP-2011) to the INSDC.
RL   Department of Pathology, University Hospital Germans Trias i Pujol,
RL   Carretera de Canyet s/n, Badalona, Barcelona 08916, Spain
XX
DR   MD5; 20595bce6e12f38904f1051672e15e68.
DR   Ensembl-Gn; ENSG00000145335; homo_sapiens.
DR   Ensembl-Tr; ENST00000345009; homo_sapiens.
DR   Ensembl-Tr; ENST00000420646; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2938
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:9606"
FT   gene            1..2938
FT                   /gene="SNCA"
FT   exon            1..45
FT                   /gene="SNCA"
FT                   /number=1
FT   exon            46..191
FT                   /gene="SNCA"
FT                   /number=3
FT   CDS             71..409
FT                   /codon_start=1
FT                   /gene="SNCA"
FT                   /product="alpha-synuclein transcript variant 10"
FT                   /note="alternatively spliced"
FT                   /db_xref="GOA:H6UYS5"
FT                   /db_xref="InterPro:IPR001058"
FT                   /db_xref="InterPro:IPR002460"
FT                   /db_xref="UniProtKB/TrEMBL:H6UYS5"
FT                   /protein_id="AFA25674.1"
FT                   /translation="MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTK
FT                   EGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKEG
FT                   YQDYEPEA"
FT   exon            192..233
FT                   /gene="SNCA"
FT                   /number=4
FT   exon            234..376
FT                   /gene="SNCA"
FT                   /number=5
FT   exon            377..2938
FT                   /gene="SNCA"
FT                   /number=7
FT   polyA_signal    671..676
FT                   /gene="SNCA"
FT   polyA_signal    952..957
FT                   /gene="SNCA"
FT   polyA_signal    957..962
FT                   /gene="SNCA"
FT   polyA_signal    2913..2918
FT                   /gene="SNCA"
XX
SQ   Sequence 2938 BP; 910 A; 470 C; 583 G; 975 T; 0 other;
     attctggtgt gatccaggaa cagctgtctt ccagctctga aagagtgtgg tgtaaaggaa        60
     ttcattagcc atggatgtat tcatgaaagg actttcaaag gccaaggagg gagttgtggc       120
     tgctgctgag aaaaccaaac agggtgtggc agaagcagca ggaaagacaa aagagggtgt       180
     tctctatgta ggctccaaaa ccaaggaggg agtggtgcat ggtgtggcaa cagtggctga       240
     gaagaccaaa gagcaagtga caaatgttgg aggagcagtg gtgacgggtg tgacagcagt       300
     agcccagaag acagtggagg gagcagggag cattgcagca gccactggct ttgtcaaaaa       360
     ggaccagttg ggcaaggaag ggtatcaaga ctacgaacct gaagcctaag aaatatcttt       420
     gctcccagtt tcttgagatc tgctgacaga tgttccatcc tgtacaagtg ctcagttcca       480
     atgtgcccag tcatgacatt tctcaaagtt tttacagtgt atctcgaagt cttccatcag       540
     cagtgattga agtatctgta cctgccccca ctcagcattt cggtgcttcc ctttcactga       600
     agtgaataca tggtagcagg gtctttgtgt gctgtggatt ttgtggcttc aatctacgat       660
     gttaaaacaa attaaaaaca cctaagtgac taccacttat ttctaaatcc tcactatttt       720
     tttgttgctg ttgttcagaa gttgttagtg atttgctatc atatattata agatttttag       780
     gtgtctttta atgatactgt ctaagaataa tgacgtattg tgaaatttgt taatatatat       840
     aatacttaaa aatatgtgag catgaaacta tgcacctata aatactaaat atgaaatttt       900
     accattttgc gatgtgtttt attcacttgt gtttgtatat aaatggtgag aattaaaata       960
     aaacgttatc tcattgcaaa aatattttat ttttatccca tctcacttta ataataaaaa      1020
     tcatgcttat aagcaacatg aattaagaac tgacacaaag gacaaaaata taaagttatt      1080
     aatagccatt tgaagaagga ggaattttag aagaggtaga gaaaatggaa cattaaccct      1140
     acactcggaa ttccctgaag caacactgcc agaagtgtgt tttggtatgc actggttcct      1200
     taagtggctg tgattaatta ttgaaagtgg ggtgttgaag accccaacta ctattgtaga      1260
     gtggtctatt tctcccttca atcctgtcaa tgtttgcttt acgtattttg gggaactgtt      1320
     gtttgatgtg tatgtgttta taattgttat acatttttaa ttgagccttt tattaacata      1380
     tattgttatt tttgtctcga aataattttt tagttaaaat ctattttgtc tgatattggt      1440
     gtgaatgctg tacctttctg acaataaata atattcgacc atgaataaaa aaaaaaaaaa      1500
     agtgggttcc cgggaactaa gcagtgtaga agatgatttt gactacaccc tccttagaga      1560
     gccataagac acattagcac atattagcac attcaaggct ctgagagaat gtggttaact      1620
     ttgtttaact cagcattcct cacttttttt ttttaatcat cagaaattct ctctctctct      1680
     ctctcttttt ctctcgctct cttttttttt ttttttttac aggaaatgcc tttaaacatc      1740
     gttggaacta ccagagtcac cttaaaggag atcaattctc tagactgata aaaatttcat      1800
     ggcctccttt aaatgttgcc aaatatatga attctaggat ttttccttag gaaaggtttt      1860
     tctctttcag ggaagatcta ttaactcccc atgggtgctg aaaataaact tgatggtgaa      1920
     aaactctgta taaattaatt taaaaattat ttggtttctc tttttaatta ttctggggca      1980
     tagtcatttc taaaagtcac tagtagaaag tataatttca agacagaata ttctagacat      2040
     gctagcagtt tatatgtatt catgagtaat gtgatatata ttgggcgctg gtgaggaagg      2100
     aaggaggaat gagtgactat aaggatggtt accatagaaa cttccttttt tacctaattg      2160
     aagagagact actacagagt gctaagctgc atgtgtcatc ttacactaga gagaaatggt      2220
     aagtttcttg ttttatttaa gttatgttta agcaaggaaa ggatttgtta ttgaacagta      2280
     tatttcagga aggttagaaa gtggcggtta ggatatattt taaatctacc taaagcagca      2340
     tattttaaaa atttaaaagt attggtatta aattaagaaa tagaggacag aactagactg      2400
     atagcagtga cctagaacaa tttgagatta ggaaagttgt gaccatgaat ttaaggattt      2460
     atgtggatac aaattctcct ttaaagtgtt tcttccctta atatttatct gacggtaatt      2520
     tttgagcagt gaattacttt atatatctta atagtttatt tgggaccaaa cacttaaaca      2580
     aaaagttctt taagtcatat aagccttttc aggaagcttg tctcatattc actcccgaga      2640
     cattcacctg ccaagtggcc tgaggatcaa tccagtccta ggtttatttt gcagacttac      2700
     attctcccaa gttattcagc ctcatatgac tccacggtcg gctttaccaa aacagttcag      2760
     agtgcacttt ggcacacaat tgggaacaga acaatctaat gtgtggtttg gtattccaag      2820
     tggggtcttt ttcagaatct ctgcactagt gtgagatgca aacatgtttc ctcatctttc      2880
     tggcttatcc agtatgtagc tatttgtgac ataataaata tatacatata tgaaaata        2938
//


spacer
spacer