Dbfetch

ID   JN709862; SV 1; linear; mRNA; STD; HUM; 3173 BP.
XX
AC   JN709862;
XX
DT   13-FEB-2012 (Rel. 111, Created)
DT   13-FEB-2012 (Rel. 111, Last updated, Version 1)
XX
DE   Homo sapiens alpha-synuclein transcript variant 8 (SNCA) mRNA, complete
DE   cds, alternatively spliced.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3173
RA   Beyer K., Munoz-Marmol A.M.;
RT   "SNCA transcript variants can be classified into four groups in dependence
RT   on their initial exon";
RL   Unpublished.
XX
RN   [2]
RP   1-3173
RA   Beyer K., Munoz-Marmol A.M.;
RT   ;
RL   Submitted (22-SEP-2011) to the INSDC.
RL   Department of Pathology, University Hospital Germans Trias i Pujol,
RL   Carretera de Canyet s/n, Badalona, Barcelona 08916, Spain
XX
DR   MD5; 0c231fdf51b37760ee7a98b9975137d0.
DR   Ensembl-Gn; ENSG00000145335; homo_sapiens.
DR   Ensembl-Tr; ENST00000394989; homo_sapiens.
DR   Ensembl-Tr; ENST00000505199; homo_sapiens.
DR   Ensembl-Tr; ENST00000618500; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3173
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:9606"
FT   gene            1..3173
FT                   /gene="SNCA"
FT   exon            1..238
FT                   /gene="SNCA"
FT                   /number=2a
FT   exon            239..384
FT                   /gene="SNCA"
FT                   /number=3
FT   CDS             264..644
FT                   /codon_start=1
FT                   /gene="SNCA"
FT                   /product="alpha-synuclein transcript variant 8"
FT                   /note="alternatively spliced"
FT                   /db_xref="GOA:H6UYS0"
FT                   /db_xref="InterPro:IPR001058"
FT                   /db_xref="InterPro:IPR002460"
FT                   /db_xref="UniProtKB/TrEMBL:H6UYS0"
FT                   /protein_id="AFA25672.1"
FT                   /translation="MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVVAEKT
FT                   KEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPV
FT                   DPDNEAYEMPSEEGYQDYEPEA"
FT   exon            385..527
FT                   /gene="SNCA"
FT                   /number=5
FT   exon            528..611
FT                   /gene="SNCA"
FT                   /number=6
FT   exon            612..3173
FT                   /gene="SNCA"
FT                   /number=7
FT   regulatory      906..911
FT                   /gene="SNCA"
FT                   /regulatory_class="polyA_signal_sequence"
FT   regulatory      1187..1192
FT                   /gene="SNCA"
FT                   /regulatory_class="polyA_signal_sequence"
FT   regulatory      1192..1197
FT                   /gene="SNCA"
FT                   /regulatory_class="polyA_signal_sequence"
FT   regulatory      3148..3153
FT                   /gene="SNCA"
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 3173 BP; 963 A; 538 C; 671 G; 1001 T; 0 other;
     aggagaagga gaaggaggag gactaggagg aggaggacgg cgacgaccag aaggggccca        60
     agagaggggg cgagcgaccg agcgccgcga cgcggaagtg aggtgcgtgc gggctgcagc       120
     gcagaccccg gcccggcccc tccgagagcg tcctgggcgc tccctcacgc cttgccttca       180
     agccttctgc ctttccaccc tcgtgagcgg agaactggga gtggccattc gacgacagtg       240
     tggtgtaaag gaattcatta gccatggatg tattcatgaa aggactttca aaggccaagg       300
     agggagttgt ggctgctgct gagaaaacca aacagggtgt ggcagaagca gcaggaaaga       360
     caaaagaggg tgttctctat gtagtggctg agaagaccaa agagcaagtg acaaatgttg       420
     gaggagcagt ggtgacgggt gtgacagcag tagcccagaa gacagtggag ggagcaggga       480
     gcattgcagc agccactggc tttgtcaaaa aggaccagtt gggcaagaat gaagaaggag       540
     ccccacagga aggaattctg gaagatatgc ctgtggatcc tgacaatgag gcttatgaaa       600
     tgccttctga ggaagggtat caagactacg aacctgaagc ctaagaaata tctttgctcc       660
     cagtttcttg agatctgctg acagatgttc catcctgtac aagtgctcag ttccaatgtg       720
     cccagtcatg acatttctca aagtttttac agtgtatctc gaagtcttcc atcagcagtg       780
     attgaagtat ctgtacctgc ccccactcag catttcggtg cttccctttc actgaagtga       840
     atacatggta gcagggtctt tgtgtgctgt ggattttgtg gcttcaatct acgatgttaa       900
     aacaaattaa aaacacctaa gtgactacca cttatttcta aatcctcact atttttttgt       960
     tgctgttgtt cagaagttgt tagtgatttg ctatcatata ttataagatt tttaggtgtc      1020
     ttttaatgat actgtctaag aataatgacg tattgtgaaa tttgttaata tatataatac      1080
     ttaaaaatat gtgagcatga aactatgcac ctataaatac taaatatgaa attttaccat      1140
     tttgcgatgt gttttattca cttgtgtttg tatataaatg gtgagaatta aaataaaacg      1200
     ttatctcatt gcaaaaatat tttattttta tcccatctca ctttaataat aaaaatcatg      1260
     cttataagca acatgaatta agaactgaca caaaggacaa aaatataaag ttattaatag      1320
     ccatttgaag aaggaggaat tttagaagag gtagagaaaa tggaacatta accctacact      1380
     cggaattccc tgaagcaaca ctgccagaag tgtgttttgg tatgcactgg ttccttaagt      1440
     ggctgtgatt aattattgaa agtggggtgt tgaagacccc aactactatt gtagagtggt      1500
     ctatttctcc cttcaatcct gtcaatgttt gctttacgta ttttggggaa ctgttgtttg      1560
     atgtgtatgt gtttataatt gttatacatt tttaattgag ccttttatta acatatattg      1620
     ttatttttgt ctcgaaataa ttttttagtt aaaatctatt ttgtctgata ttggtgtgaa      1680
     tgctgtacct ttctgacaat aaataatatt cgaccatgaa taaaaaaaaa aaaaaagtgg      1740
     gttcccggga actaagcagt gtagaagatg attttgacta caccctcctt agagagccat      1800
     aagacacatt agcacatatt agcacattca aggctctgag agaatgtggt taactttgtt      1860
     taactcagca ttcctcactt ttttttttta atcatcagaa attctctctc tctctctctc      1920
     tttttctctc gctctctttt tttttttttt tttacaggaa atgcctttaa acatcgttgg      1980
     aactaccaga gtcaccttaa aggagatcaa ttctctagac tgataaaaat ttcatggcct      2040
     cctttaaatg ttgccaaata tatgaattct aggatttttc cttaggaaag gtttttctct      2100
     ttcagggaag atctattaac tccccatggg tgctgaaaat aaacttgatg gtgaaaaact      2160
     ctgtataaat taatttaaaa attatttggt ttctcttttt aattattctg gggcatagtc      2220
     atttctaaaa gtcactagta gaaagtataa tttcaagaca gaatattcta gacatgctag      2280
     cagtttatat gtattcatga gtaatgtgat atatattggg cgctggtgag gaaggaagga      2340
     ggaatgagtg actataagga tggttaccat agaaacttcc ttttttacct aattgaagag      2400
     agactactac agagtgctaa gctgcatgtg tcatcttaca ctagagagaa atggtaagtt      2460
     tcttgtttta tttaagttat gtttaagcaa ggaaaggatt tgttattgaa cagtatattt      2520
     caggaaggtt agaaagtggc ggttaggata tattttaaat ctacctaaag cagcatattt      2580
     taaaaattta aaagtattgg tattaaatta agaaatagag gacagaacta gactgatagc      2640
     agtgacctag aacaatttga gattaggaaa gttgtgacca tgaatttaag gatttatgtg      2700
     gatacaaatt ctcctttaaa gtgtttcttc ccttaatatt tatctgacgg taatttttga      2760
     gcagtgaatt actttatata tcttaatagt ttatttggga ccaaacactt aaacaaaaag      2820
     ttctttaagt catataagcc ttttcaggaa gcttgtctca tattcactcc cgagacattc      2880
     acctgccaag tggcctgagg atcaatccag tcctaggttt attttgcaga cttacattct      2940
     cccaagttat tcagcctcat atgactccac ggtcggcttt accaaaacag ttcagagtgc      3000
     actttggcac acaattggga acagaacaat ctaatgtgtg gtttggtatt ccaagtgggg      3060
     tctttttcag aatctctgca ctagtgtgag atgcaaacat gtttcctcat ctttctggct      3120
     tatccagtat gtagctattt gtgacataat aaatatatac atatatgaaa ata             3173
//