spacer

EBI Dbfetch

ID   JN709861; SV 1; linear; mRNA; STD; HUM; 3131 BP.
XX
AC   JN709861;
XX
DT   13-FEB-2012 (Rel. 111, Created)
DT   13-FEB-2012 (Rel. 111, Last updated, Version 1)
XX
DE   Homo sapiens alpha-synuclein transcript variant 7 (SNCA) mRNA, complete
DE   cds, alternatively spliced.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3131
RA   Beyer K., Munoz-Marmol A.M.;
RT   "SNCA transcript variants can be classified into four groups in dependence
RT   on their initial exon";
RL   Unpublished.
XX
RN   [2]
RP   1-3131
RA   Beyer K., Munoz-Marmol A.M.;
RT   ;
RL   Submitted (22-SEP-2011) to the INSDC.
RL   Department of Pathology, University Hospital Germans Trias i Pujol,
RL   Carretera de Canyet s/n, Badalona, Barcelona 08916, Spain
XX
DR   MD5; 24587d2b5007ec5818ed4081412b77bd.
DR   Ensembl-Gn; ENSG00000145335; homo_sapiens.
DR   Ensembl-Tr; ENST00000345009; homo_sapiens.
DR   Ensembl-Tr; ENST00000420646; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3131
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:9606"
FT   gene            1..3131
FT                   /gene="SNCA"
FT   exon            1..238
FT                   /gene="SNCA"
FT                   /number=2a
FT   exon            239..384
FT                   /gene="SNCA"
FT                   /number=3
FT   CDS             264..602
FT                   /codon_start=1
FT                   /gene="SNCA"
FT                   /product="alpha-synuclein transcript variant 7"
FT                   /note="alternatively spliced"
FT                   /db_xref="GOA:H6UYS5"
FT                   /db_xref="InterPro:IPR001058"
FT                   /db_xref="InterPro:IPR002460"
FT                   /db_xref="UniProtKB/TrEMBL:H6UYS5"
FT                   /protein_id="AFA25671.1"
FT                   /translation="MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTK
FT                   EGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKEG
FT                   YQDYEPEA"
FT   exon            385..426
FT                   /gene="SNCA"
FT                   /number=4
FT   exon            427..569
FT                   /gene="SNCA"
FT                   /number=5
FT   exon            570..3131
FT                   /gene="SNCA"
FT                   /number=7
FT   regulatory      864..869
FT                   /gene="SNCA"
FT                   /regulatory_class="polyA_signal_sequence"
FT   regulatory      1145..1150
FT                   /gene="SNCA"
FT                   /regulatory_class="polyA_signal_sequence"
FT   regulatory      1150..1155
FT                   /gene="SNCA"
FT                   /regulatory_class="polyA_signal_sequence"
FT   regulatory      3106..3111
FT                   /gene="SNCA"
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 3131 BP; 948 A; 531 C; 663 G; 989 T; 0 other;
     aggagaagga gaaggaggag gactaggagg aggaggacgg cgacgaccag aaggggccca        60
     agagaggggg cgagcgaccg agcgccgcga cgcggaagtg aggtgcgtgc gggctgcagc       120
     gcagaccccg gcccggcccc tccgagagcg tcctgggcgc tccctcacgc cttgccttca       180
     agccttctgc ctttccaccc tcgtgagcgg agaactggga gtggccattc gacgacagtg       240
     tggtgtaaag gaattcatta gccatggatg tattcatgaa aggactttca aaggccaagg       300
     agggagttgt ggctgctgct gagaaaacca aacagggtgt ggcagaagca gcaggaaaga       360
     caaaagaggg tgttctctat gtaggctcca aaaccaagga gggagtggtg catggtgtgg       420
     caacagtggc tgagaagacc aaagagcaag tgacaaatgt tggaggagca gtggtgacgg       480
     gtgtgacagc agtagcccag aagacagtgg agggagcagg gagcattgca gcagccactg       540
     gctttgtcaa aaaggaccag ttgggcaagg aagggtatca agactacgaa cctgaagcct       600
     aagaaatatc tttgctccca gtttcttgag atctgctgac agatgttcca tcctgtacaa       660
     gtgctcagtt ccaatgtgcc cagtcatgac atttctcaaa gtttttacag tgtatctcga       720
     agtcttccat cagcagtgat tgaagtatct gtacctgccc ccactcagca tttcggtgct       780
     tccctttcac tgaagtgaat acatggtagc agggtctttg tgtgctgtgg attttgtggc       840
     ttcaatctac gatgttaaaa caaattaaaa acacctaagt gactaccact tatttctaaa       900
     tcctcactat ttttttgttg ctgttgttca gaagttgtta gtgatttgct atcatatatt       960
     ataagatttt taggtgtctt ttaatgatac tgtctaagaa taatgacgta ttgtgaaatt      1020
     tgttaatata tataatactt aaaaatatgt gagcatgaaa ctatgcacct ataaatacta      1080
     aatatgaaat tttaccattt tgcgatgtgt tttattcact tgtgtttgta tataaatggt      1140
     gagaattaaa ataaaacgtt atctcattgc aaaaatattt tatttttatc ccatctcact      1200
     ttaataataa aaatcatgct tataagcaac atgaattaag aactgacaca aaggacaaaa      1260
     atataaagtt attaatagcc atttgaagaa ggaggaattt tagaagaggt agagaaaatg      1320
     gaacattaac cctacactcg gaattccctg aagcaacact gccagaagtg tgttttggta      1380
     tgcactggtt ccttaagtgg ctgtgattaa ttattgaaag tggggtgttg aagaccccaa      1440
     ctactattgt agagtggtct atttctccct tcaatcctgt caatgtttgc tttacgtatt      1500
     ttggggaact gttgtttgat gtgtatgtgt ttataattgt tatacatttt taattgagcc      1560
     ttttattaac atatattgtt atttttgtct cgaaataatt ttttagttaa aatctatttt      1620
     gtctgatatt ggtgtgaatg ctgtaccttt ctgacaataa ataatattcg accatgaata      1680
     aaaaaaaaaa aaaagtgggt tcccgggaac taagcagtgt agaagatgat tttgactaca      1740
     ccctccttag agagccataa gacacattag cacatattag cacattcaag gctctgagag      1800
     aatgtggtta actttgttta actcagcatt cctcactttt tttttttaat catcagaaat      1860
     tctctctctc tctctctctt tttctctcgc tctctttttt tttttttttt tacaggaaat      1920
     gcctttaaac atcgttggaa ctaccagagt caccttaaag gagatcaatt ctctagactg      1980
     ataaaaattt catggcctcc tttaaatgtt gccaaatata tgaattctag gatttttcct      2040
     taggaaaggt ttttctcttt cagggaagat ctattaactc cccatgggtg ctgaaaataa      2100
     acttgatggt gaaaaactct gtataaatta atttaaaaat tatttggttt ctctttttaa      2160
     ttattctggg gcatagtcat ttctaaaagt cactagtaga aagtataatt tcaagacaga      2220
     atattctaga catgctagca gtttatatgt attcatgagt aatgtgatat atattgggcg      2280
     ctggtgagga aggaaggagg aatgagtgac tataaggatg gttaccatag aaacttcctt      2340
     ttttacctaa ttgaagagag actactacag agtgctaagc tgcatgtgtc atcttacact      2400
     agagagaaat ggtaagtttc ttgttttatt taagttatgt ttaagcaagg aaaggatttg      2460
     ttattgaaca gtatatttca ggaaggttag aaagtggcgg ttaggatata ttttaaatct      2520
     acctaaagca gcatatttta aaaatttaaa agtattggta ttaaattaag aaatagagga      2580
     cagaactaga ctgatagcag tgacctagaa caatttgaga ttaggaaagt tgtgaccatg      2640
     aatttaagga tttatgtgga tacaaattct cctttaaagt gtttcttccc ttaatattta      2700
     tctgacggta atttttgagc agtgaattac tttatatatc ttaatagttt atttgggacc      2760
     aaacacttaa acaaaaagtt ctttaagtca tataagcctt ttcaggaagc ttgtctcata      2820
     ttcactcccg agacattcac ctgccaagtg gcctgaggat caatccagtc ctaggtttat      2880
     tttgcagact tacattctcc caagttattc agcctcatat gactccacgg tcggctttac      2940
     caaaacagtt cagagtgcac tttggcacac aattgggaac agaacaatct aatgtgtggt      3000
     ttggtattcc aagtggggtc tttttcagaa tctctgcact agtgtgagat gcaaacatgt      3060
     ttcctcatct ttctggctta tccagtatgt agctatttgt gacataataa atatatacat      3120
     atatgaaaat a                                                           3131
//


spacer
spacer