spacer

EBI Dbfetch

ID   JN709859; SV 1; linear; mRNA; STD; HUM; 3169 BP.
XX
AC   JN709859;
XX
DT   13-FEB-2012 (Rel. 111, Created)
DT   13-FEB-2012 (Rel. 111, Last updated, Version 1)
XX
DE   Homo sapiens alpha-synuclein transcript variant 5 (SNCA) mRNA, complete
DE   cds, alternatively spliced.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3169
RA   Beyer K., Munoz-Marmol A.M.;
RT   "SNCA transcript variants can be classified into four groups in dependence
RT   on their initial exon";
RL   Unpublished.
XX
RN   [2]
RP   1-3169
RA   Beyer K., Munoz-Marmol A.M.;
RT   ;
RL   Submitted (22-SEP-2011) to the INSDC.
RL   Department of Pathology, University Hospital Germans Trias i Pujol,
RL   Carretera de Canyet s/n, Badalona, Barcelona 08916, Spain
XX
DR   MD5; f0a5c5c80b93eb1444fa1f5cd4204912.
DR   Ensembl-Gn; ENSG00000145335; homo_sapiens.
DR   Ensembl-Tr; ENST00000394989; homo_sapiens.
DR   Ensembl-Tr; ENST00000505199; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3169
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:9606"
FT   gene            1..3169
FT                   /gene="SNCA"
FT   exon            1..234
FT                   /gene="SNCA"
FT                   /number=2b
FT   exon            235..380
FT                   /gene="SNCA"
FT                   /number=3
FT   CDS             260..640
FT                   /codon_start=1
FT                   /gene="SNCA"
FT                   /product="alpha-synuclein transcript variant 5"
FT                   /note="alternatively spliced"
FT                   /db_xref="GOA:H6UYS0"
FT                   /db_xref="InterPro:IPR001058"
FT                   /db_xref="InterPro:IPR002460"
FT                   /db_xref="UniProtKB/TrEMBL:H6UYS0"
FT                   /protein_id="AFA25669.1"
FT                   /translation="MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVVAEKT
FT                   KEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPV
FT                   DPDNEAYEMPSEEGYQDYEPEA"
FT   exon            381..523
FT                   /gene="SNCA"
FT                   /number=5
FT   exon            524..607
FT                   /gene="SNCA"
FT                   /number=6
FT   exon            608..3169
FT                   /gene="SNCA"
FT                   /number=7
FT   polyA_signal    902..907
FT                   /gene="SNCA"
FT   polyA_signal    1183..1188
FT                   /gene="SNCA"
FT   polyA_signal    1188..1193
FT                   /gene="SNCA"
FT   polyA_signal    3144..3149
FT                   /gene="SNCA"
XX
SQ   Sequence 3169 BP; 956 A; 534 C; 641 G; 1038 T; 0 other;
     gccattcgac gacaggttag cgggtttgcc tcccactccc ccagcctcgc gtcgccggct        60
     cacagcggcc tcctctgggg acagtccccc ccgggtgccg cctccgccct tcctgtgcgc       120
     tccttttcct tcttctttcc tattaaatat tatttgggaa ttgtttaaat ttttttttta       180
     aaaaaagaga gaggcgggga ggagtcggag ttgtggagaa gcagagggac tcagtgtggt       240
     gtaaaggaat tcattagcca tggatgtatt catgaaagga ctttcaaagg ccaaggaggg       300
     agttgtggct gctgctgaga aaaccaaaca gggtgtggca gaagcagcag gaaagacaaa       360
     agagggtgtt ctctatgtag tggctgagaa gaccaaagag caagtgacaa atgttggagg       420
     agcagtggtg acgggtgtga cagcagtagc ccagaagaca gtggagggag cagggagcat       480
     tgcagcagcc actggctttg tcaaaaagga ccagttgggc aagaatgaag aaggagcccc       540
     acaggaagga attctggaag atatgcctgt ggatcctgac aatgaggctt atgaaatgcc       600
     ttctgaggaa gggtatcaag actacgaacc tgaagcctaa gaaatatctt tgctcccagt       660
     ttcttgagat ctgctgacag atgttccatc ctgtacaagt gctcagttcc aatgtgccca       720
     gtcatgacat ttctcaaagt ttttacagtg tatctcgaag tcttccatca gcagtgattg       780
     aagtatctgt acctgccccc actcagcatt tcggtgcttc cctttcactg aagtgaatac       840
     atggtagcag ggtctttgtg tgctgtggat tttgtggctt caatctacga tgttaaaaca       900
     aattaaaaac acctaagtga ctaccactta tttctaaatc ctcactattt ttttgttgct       960
     gttgttcaga agttgttagt gatttgctat catatattat aagattttta ggtgtctttt      1020
     aatgatactg tctaagaata atgacgtatt gtgaaatttg ttaatatata taatacttaa      1080
     aaatatgtga gcatgaaact atgcacctat aaatactaaa tatgaaattt taccattttg      1140
     cgatgtgttt tattcacttg tgtttgtata taaatggtga gaattaaaat aaaacgttat      1200
     ctcattgcaa aaatatttta tttttatccc atctcacttt aataataaaa atcatgctta      1260
     taagcaacat gaattaagaa ctgacacaaa ggacaaaaat ataaagttat taatagccat      1320
     ttgaagaagg aggaatttta gaagaggtag agaaaatgga acattaaccc tacactcgga      1380
     attccctgaa gcaacactgc cagaagtgtg ttttggtatg cactggttcc ttaagtggct      1440
     gtgattaatt attgaaagtg gggtgttgaa gaccccaact actattgtag agtggtctat      1500
     ttctcccttc aatcctgtca atgtttgctt tacgtatttt ggggaactgt tgtttgatgt      1560
     gtatgtgttt ataattgtta tacattttta attgagcctt ttattaacat atattgttat      1620
     ttttgtctcg aaataatttt ttagttaaaa tctattttgt ctgatattgg tgtgaatgct      1680
     gtacctttct gacaataaat aatattcgac catgaataaa aaaaaaaaaa aagtgggttc      1740
     ccgggaacta agcagtgtag aagatgattt tgactacacc ctccttagag agccataaga      1800
     cacattagca catattagca cattcaaggc tctgagagaa tgtggttaac tttgtttaac      1860
     tcagcattcc tcactttttt tttttaatca tcagaaattc tctctctctc tctctctttt      1920
     tctctcgctc tctttttttt ttttttttta caggaaatgc ctttaaacat cgttggaact      1980
     accagagtca ccttaaagga gatcaattct ctagactgat aaaaatttca tggcctcctt      2040
     taaatgttgc caaatatatg aattctagga tttttcctta ggaaaggttt ttctctttca      2100
     gggaagatct attaactccc catgggtgct gaaaataaac ttgatggtga aaaactctgt      2160
     ataaattaat ttaaaaatta tttggtttct ctttttaatt attctggggc atagtcattt      2220
     ctaaaagtca ctagtagaaa gtataatttc aagacagaat attctagaca tgctagcagt      2280
     ttatatgtat tcatgagtaa tgtgatatat attgggcgct ggtgaggaag gaaggaggaa      2340
     tgagtgacta taaggatggt taccatagaa acttcctttt ttacctaatt gaagagagac      2400
     tactacagag tgctaagctg catgtgtcat cttacactag agagaaatgg taagtttctt      2460
     gttttattta agttatgttt aagcaaggaa aggatttgtt attgaacagt atatttcagg      2520
     aaggttagaa agtggcggtt aggatatatt ttaaatctac ctaaagcagc atattttaaa      2580
     aatttaaaag tattggtatt aaattaagaa atagaggaca gaactagact gatagcagtg      2640
     acctagaaca atttgagatt aggaaagttg tgaccatgaa tttaaggatt tatgtggata      2700
     caaattctcc tttaaagtgt ttcttccctt aatatttatc tgacggtaat ttttgagcag      2760
     tgaattactt tatatatctt aatagtttat ttgggaccaa acacttaaac aaaaagttct      2820
     ttaagtcata taagcctttt caggaagctt gtctcatatt cactcccgag acattcacct      2880
     gccaagtggc ctgaggatca atccagtcct aggtttattt tgcagactta cattctccca      2940
     agttattcag cctcatatga ctccacggtc ggctttacca aaacagttca gagtgcactt      3000
     tggcacacaa ttgggaacag aacaatctaa tgtgtggttt ggtattccaa gtggggtctt      3060
     tttcagaatc tctgcactag tgtgagatgc aaacatgttt cctcatcttt ctggcttatc      3120
     cagtatgtag ctatttgtga cataataaat atatacatat atgaaaata                  3169
//


spacer
spacer