spacer

EBI Dbfetch

ID   JF796681; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   JF796681;
XX
DT   14-JUL-2011 (Rel. 109, Created)
DT   14-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*15:01var
DE   allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Recker K., Fuerst D., Robin-Winn M., Mytilineos J.;
RT   "A new variant of HLA-DRB1*15:01";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Recker K., Fuerst D., Robin-Winn M., Mytilineos J.;
RT   ;
RL   Submitted (11-APR-2011) to the INSDC.
RL   Transplantation Immunology, IKT Ulm, Helmholtzstrasse 10, Ulm 89081,
RL   Germany
XX
DR   MD5; 2734c2f7e4033e8baec67a45e70ffe77.
DR   Ensembl-Gn; ENSG00000196126; homo_sapiens.
DR   Ensembl-Tr; ENST00000360004; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*15:01var"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*15:01var"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*15:01var"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:G1CD91"
FT                   /db_xref="IMGT/HLA:DRB1*15:01:13"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:G1CD91"
FT                   /protein_id="AEJ87208.1"
FT                   /translation="RFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRR"
XX
SQ   Sequence 270 BP; 56 A; 65 C; 101 G; 48 T; 0 other;
     cacgtttcct gtggcagcct aagagggagt gtcatttctt caatgggacg gagagggtgc        60
     ggttcctgga cagatacttc tataaccagg aggagtccgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgacgc tgagtactgg aacagccaga       180
     aggacatcct ggagcaggcg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer