spacer

EBI Dbfetch

ID   J04566; SV 1; linear; mRNA; STD; MUS; 1985 BP.
XX
AC   J04566;
XX
DT   25-MAY-1990 (Rel. 24, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Mouse Vgr-1 protein mRNA, complete cds.
XX
KW   Vgr-1 protein.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1985
RX   DOI; 10.1073/pnas.86.12.4554.
RX   PUBMED; 2734307.
RA   Lyons K., Graycar J.L., Lee A., Hashmi S., Lindquist P.B., Chen E.Y.,
RA   Hogan B.L.M., Derynck R.;
RT   "Vgr-1, a mammalian gene related to Xenopus Vg-1, is a member of the
RT   transforming growth factor beta gene superfamily";
RL   Proc. Natl. Acad. Sci. U.S.A. 86(12):4554-4558(1989).
XX
DR   MD5; ab7e9a6b3b3b0bbc12eca6ebc8c64427.
DR   Ensembl-Gn; ENSMUSG00000039004; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171970; mus_musculus.
XX
CC   Draft entry and printed sequence for [1] kindly submitted by A.Lee.
CC   22-MAY-1989, for release after publication.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1985
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             16..1332
FT                   /codon_start=1
FT                   /note="Vgr-1 protein"
FT                   /db_xref="GOA:P20722"
FT                   /db_xref="InterPro:IPR001111"
FT                   /db_xref="InterPro:IPR001839"
FT                   /db_xref="InterPro:IPR002405"
FT                   /db_xref="InterPro:IPR015615"
FT                   /db_xref="InterPro:IPR017948"
FT                   /db_xref="InterPro:IPR029034"
FT                   /db_xref="MGI:MGI:88182"
FT                   /db_xref="UniProtKB/Swiss-Prot:P20722"
FT                   /protein_id="AAA40548.1"
FT                   /translation="MRKMQKEILSVLGPPHRPRPLHGLQQPQPPVLPPQQQQQQQQQQT
FT                   AREEPPPGRLKSAPLFMLDLYNALSNDDEEDGASEGVGQEPGSHGGASSSQLRQPSPGA
FT                   AHSLNRKSLLAPGPGGGASPLTSAQDSAFLNDADMVMSFVNLVEYDKEFSPHQRHHKEF
FT                   KFNLSQIPEGEAVTAAEFRVYKDCVVGSFKNQTFLISIYQVLQEHQHRDSDLFLLDTRV
FT                   VWASEEGWLEFDITATSNLWVVTPQHNMGLQLSVVTRDGLHVNPRAAGLVGRDGPYDKQ
FT                   PFMVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVSRGSGSSDYNGSELKTACKKH
FT                   ELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVHLMNPEYVP
FT                   KPCCAPTKLNAISVLYFDDNSNVILKKYRNMVVRACGCH"
XX
SQ   Sequence 1985 BP; 448 A; 566 C; 551 G; 420 T; 0 other;
     ccttgaccgt aagacatgag gaagatgcaa aaggagatcc tgtcggtgct ggggcccccg        60
     cacaggccgc ggcccctgca cggtctccag cagcctcagc ccccggtgct cccgccacag       120
     cagcagcagc agcagcagca gcagcagacg gcccgcgagg agccccctcc agggcggctg       180
     aagtccgctc cactcttcat gctggatctc tacaacgccc tgtccaatga cgacgaagag       240
     gatggggcat cggagggtgt ggggcaagag cctgggtccc acggaggggc cagctcgtcc       300
     cagctcaggc agccgtctcc cggcgctgca cactccttga accgcaagag tctcctggcc       360
     ccgggacccg gtggcggtgc gtccccactg actagcgcgc aggacagcgc tttcctcaac       420
     gacgcggaca tggtcatgag ctttgtgaac ctggtggagt acgacaagga gttctcccca       480
     catcaacgac accacaaaga gttcaagttc aacctatccc agattcctga gggtgaggcg       540
     gtgacggctg ctgagttccg cgtctacaag gactgtgtgg tggggagttt taaaaaccaa       600
     acctttctta tcagcattta ccaagtcttg caggagcatc agcacagaga ctctgaccta       660
     tttttgttgg acacccgggt ggtgtgggcc tcagaagaag gttggctgga atttgacatc       720
     acagcaacta gcaatctgtg ggtggtgaca ccgcagcaca acatggggct ccagctgagt       780
     gtggtgactc gggatggact ccacgtcaac ccccgtgcgg cgggcctggt gggcagagac       840
     ggcccttacg acaagcagcc cttcatggtg gccttcttca aggtgagcga ggtccacgtg       900
     cgcaccacca ggtcagcctc cagtcggcgg cggcagcaga gtcgcaaccg gtccacccag       960
     tcgcaggacg tgtcccgggg ctccggttct tcagactaca acggcagtga gttaaaaaca      1020
     gcttgcaaga agcatgagct ctatgtgagc ttccaggacc tgggatggca ggactggatc      1080
     attgcaccca aaggctacgc tgccaactac tgtgatggag agtgttcctt cccactcaac      1140
     gcacacatga atgccaccaa ccacgccatt gtacagacct tggtccacct tatgaatccc      1200
     gagtacgtcc ccaaaccatg ctgcgcacca accaaactga atgccatctc ggttctttac      1260
     ttcgatgata actccaatgt catcttgaaa aagtacagga atatggtcgt gagagcttgt      1320
     ggttgccatt aagttgaagc tggtgtgtgt gtgtgggtgg gggcatggtt ctgccttgga      1380
     ttcctaacaa caacatctgc cttaaaccac gaacaacagc acagcgaagc gggatggtga      1440
     cacacagagg gatcgtgaca cgcagacaca tctcccgctg gtgccttacc cacggaggct      1500
     tttatgagga ccttgtcaag ggctttccca gttcctaact gagcagttgc tggtctgcag      1560
     gaagctggaa ggcttgtagt acaggcctgg aaactgcagt tacctaatgt tcgcctcccc      1620
     caaccccgcc cggagtagtt ttagctttta gatctagctg cttgtggtgt aagtaaactt      1680
     gaaggaatat taaatatccc tgggttgaaa gacccggtgg tggctctaca gcacccatcc      1740
     cagggagatt tttgcagaca tccgaatgga ggggagaagg gcactctttc aggttccatt      1800
     cccagcaagg gcagctcaca caggacctgc agcctggcca tcagcaggct ctgtggaggt      1860
     gccttctgtc tactgttgta gttacgtgtt ttgtgttgac tctcggtggt gtgagaatgt      1920
     actaatctct gtcaagacaa actgtagcat ttccacccca tcctcctccc tccctcacag      1980
     aattc                                                                  1985
//


spacer
spacer