spacer

EBI Dbfetch

ID   J03299; SV 1; linear; mRNA; STD; MUS; 393 BP.
XX
AC   J03299; J02737;
XX
DT   25-APR-1990 (Rel. 23, Created)
DT   04-MAR-2000 (Rel. 63, Last updated, Version 2)
XX
DE   Mouse liver transferrin mRNA.
XX
KW   transferrin.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-393
RX   PUBMED; 3611056.
RA   Pentecost B.T., Teng C.T.;
RT   "Lactotransferrin is the major estrogen inducible protein of mouse uterine
RT   secretions";
RL   J Biol Chem 262(21):10134-10139(1987).
XX
DR   MD5; 16c07597ed0c31d1f9f512286f72e570.
DR   Ensembl-Gn; ENSMUSG00000032554; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035158; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112645; mus_musculus.
XX
CC   Draft entry and computer-readable copy of sequence in [1] kindly
CC   provided by C.T.Teng, 08-JUN-1987.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..393
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..>393
FT                   /codon_start=1
FT                   /note="liver transferrin"
FT                   /db_xref="GOA:Q921I1"
FT                   /db_xref="InterPro:IPR001156"
FT                   /db_xref="InterPro:IPR016357"
FT                   /db_xref="InterPro:IPR018195"
FT                   /db_xref="MGI:MGI:98821"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q921I1"
FT                   /protein_id="AAA39438.1"
FT                   /translation="IWEILKVAQEHFGKGKSKDFQLFSSPLGKDLLFKDSAFGLLRVPP
FT                   RMDYRLYLGHNYVTAIRNQQEGVSAEGSIDNSPVKWCALSHLERTKCDEWSIISEGKIE
FT                   CESAETTEDCIEKIVNGEADAMTLDGG"
XX
SQ   Sequence 393 BP; 109 A; 84 C; 117 G; 83 T; 0 other;
     atctgggaga ttctcaaagt ggcacaggaa cactttggca aaggcaaatc aaaagacttc        60
     caactgttca gctctcctct tgggaaagac ctgctgttta aagattctgc ctttgggctg       120
     ttaagggtcc ccccaaggat ggactacagg ctgtaccttg gccataacta tgtcactgcc       180
     attcggaatc agcaggaagg cgtgtccgcg gagggctcga tcgacaactc gccagtgaag       240
     tggtgtgcac tgagtcacct ggagagaacc aagtgtgacg agtggagcat catcagtgag       300
     ggaaagatag agtgtgagtc agcagagacc actgaggact gcattgaaaa gattgtgaac       360
     ggagaagcgg acgccatgac tttggatgga gga                                    393
//


spacer
spacer