spacer

EBI Dbfetch

ID   HQ830269; SV 1; linear; mRNA; STD; HUM; 364 BP.
XX
AC   HQ830269;
XX
DT   31-MAY-2011 (Rel. 109, Created)
DT   31-MAY-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens clone asynex1`` synuclein alpha-140 (NACP) mRNA, 5' UTR and
DE   partial cds, alternatively spliced.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-364
RA   Baltic S., Thompson P.J., Misso N.L., Fogel-Petrovic M.;
RT   "Pro-inflammatory stimuli modulate alpha-synuclein expression in human
RT   monocyte-derived dendritic cells: role of a novel exon 1 splice variant";
RL   Unpublished.
XX
RN   [2]
RP   1-364
RA   Baltic S., Thompson P.J., Misso N.L., Fogel-Petrovic M.;
RT   ;
RL   Submitted (24-DEC-2010) to the INSDC.
RL   Molecular Genetics Unit, Lung Institute of Western Australia, University of
RL   Western Australia, 1st Floor, B Block, SCGH, Perth, WA 6009, Australia
XX
DR   MD5; c6b4d1fca0f551b513eb1c4cd232356c.
DR   Ensembl-Gn; ENSG00000145335; homo_sapiens.
DR   Ensembl-Tr; ENST00000336904; homo_sapiens.
DR   Ensembl-Tr; ENST00000345009; homo_sapiens.
DR   Ensembl-Tr; ENST00000394986; homo_sapiens.
DR   Ensembl-Tr; ENST00000394991; homo_sapiens.
DR   Ensembl-Tr; ENST00000420646; homo_sapiens.
DR   Ensembl-Tr; ENST00000502987; homo_sapiens.
DR   Ensembl-Tr; ENST00000506244; homo_sapiens.
DR   Ensembl-Tr; ENST00000508895; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..364
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /collection_date="Feb-2007"
FT                   /clone="asynex1``"
FT                   /cell_type="dendritic cells"
FT                   /db_xref="taxon:9606"
FT   gene            1..>364
FT                   /gene="NACP"
FT   5'UTR           1..125
FT                   /gene="NACP"
FT                   /note="alternatively spliced"
FT   CDS             126..>364
FT                   /codon_start=1
FT                   /gene="NACP"
FT                   /product="synuclein alpha-140"
FT                   /db_xref="GOA:F6L6N6"
FT                   /db_xref="InterPro:IPR001058"
FT                   /db_xref="UniProtKB/TrEMBL:F6L6N6"
FT                   /protein_id="AEG20817.1"
FT                   /translation="MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTK
FT                   EGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQ"
XX
SQ   Sequence 364 BP; 114 A; 59 C; 140 G; 51 T; 0 other;
     gagaaggaga aggaggagga ctaggaggag gaggacggcg acgaccagaa ggggcccaag        60
     agagggggcg agcgaccgag cgccgcgacg cggaagtgag tgtggtgtaa aggaattcat       120
     tagccatgga tgtattcatg aaaggacttt caaaggccaa ggagggagtt gtggctgctg       180
     ctgagaaaac caaacagggt gtggcagaag cagcaggaaa gacaaaagag ggtgttctct       240
     atgtaggctc caaaaccaag gagggagtgg tgcatggtgt ggcaacagtg gctgagaaga       300
     ccaaagagca agtgacaaat gttggaggag cagtggtgac gggtgtgaca gcagtagccc       360
     agaa                                                                    364
//


spacer
spacer