Dbfetch

ID   HQ830268; SV 1; linear; mRNA; STD; HUM; 674 BP.
XX
AC   HQ830268;
XX
DT   31-MAY-2011 (Rel. 109, Created)
DT   31-MAY-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens clone asynex1` synuclein alpha-140 (NACP) mRNA, 5' UTR and
DE   partial cds, alternatively spliced.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-674
RA   Baltic S., Thompson P.J., Misso N.L., Fogel-Petrovic M.;
RT   "Pro-inflammatory stimuli modulate alpha-synuclein expression in human
RT   monocyte-derived dendritic cells: role of a novel exon 1 splice variant";
RL   Unpublished.
XX
RN   [2]
RP   1-674
RA   Baltic S., Thompson P.J., Misso N.L., Fogel-Petrovic M.;
RT   ;
RL   Submitted (24-DEC-2010) to the INSDC.
RL   Molecular Genetics Unit, Lung Institute of Western Australia, University of
RL   Western Australia, 1st Floor, B Block, SCGH, Perth, WA 6009, Australia
XX
DR   MD5; 0f2ef585dc36d737ebb73fdea07ab4de.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..674
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /collection_date="Feb-2007"
FT                   /clone="asynex1`"
FT                   /cell_type="dendritic cells"
FT                   /db_xref="taxon:9606"
FT   gene            1..>674
FT                   /gene="NACP"
FT   5'UTR           1..435
FT                   /gene="NACP"
FT                   /note="alternatively spliced"
FT   CDS             436..>674
FT                   /codon_start=1
FT                   /gene="NACP"
FT                   /product="synuclein alpha-140"
FT                   /db_xref="GOA:F6L6N6"
FT                   /db_xref="InterPro:IPR001058"
FT                   /db_xref="InterPro:IPR002460"
FT                   /db_xref="UniProtKB/TrEMBL:F6L6N6"
FT                   /protein_id="AEG20816.1"
FT                   /translation="MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTK
FT                   EGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQ"
XX
SQ   Sequence 674 BP; 155 A; 167 C; 217 G; 135 T; 0 other;
     agaaggggcc caagagaggg ggcgagcgac cgagcgccgc gacgcggaag tgaggtgcgt        60
     gcgggctgca gcgcagaccc cggcccggcc cctccgagag cgtcctgggc gctccctcac       120
     gccttgcctt caagccttct gcctttccac cctcgtgagc ggagaactgg gagtggccat       180
     tcgacgacag gttagcgggt ttgcctccca ctcccccagc ctcgcgtcgc cggctcacag       240
     cggcctcctc tggggacagt cccccccggg tgccgcctcc gcccttcctg tgcgctcctt       300
     ttccttcttc tttcctatta aatattattt gggaattgtt taaatttttt ttttaaaaaa       360
     aagagagagg cggggaggag tcggagttgt ggagaagcag agggactcag tgtggtgtaa       420
     aggaattcat tagccatgga tgtattcatg aaaggacttt caaaggccaa ggagggagtt       480
     gtggctgctg ctgagaaaac caaacagggt gtggcagaag cagcaggaaa gacaaaagag       540
     ggtgttctct atgtaggctc caaaaccaag gagggagtgg tgcatggtgt ggcaacagtg       600
     gctgagaaga ccaaagagca agtgacaaat gttggaggag cagtggtgac gggtgtgaca       660
     gcagtagccc agaa                                                         674
//