spacer

EBI Dbfetch

ID   HQ830267; SV 1; linear; mRNA; STD; HUM; 511 BP.
XX
AC   HQ830267;
XX
DT   31-MAY-2011 (Rel. 109, Created)
DT   31-MAY-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens clone asynex1 synuclein alpha-140 (NACP) mRNA, 5' UTR and
DE   partial cds, alternatively spliced.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-511
RA   Baltic S., Thompson P.J., Misso N.L., Fogel-Petrovic M.;
RT   "Pro-inflammatory stimuli modulate alpha-synuclein expression in human
RT   monocyte-derived dendritic cells: role of a novel exon 1 splice variant";
RL   Unpublished.
XX
RN   [2]
RP   1-511
RA   Baltic S., Thompson P.J., Misso N.L., Fogel-Petrovic M.;
RT   ;
RL   Submitted (24-DEC-2010) to the INSDC.
RL   Molecular Genetics Unit, Lung Institute of Western Australia, University of
RL   Western Australia, 1st Floor, B Block, SCGH, Perth, WA 6009, Australia
XX
DR   MD5; 14202dd8717f59812cfe74ac683459f6.
DR   Ensembl-Gn; ENSG00000145335; homo_sapiens.
DR   Ensembl-Tr; ENST00000336904; homo_sapiens.
DR   Ensembl-Tr; ENST00000345009; homo_sapiens.
DR   Ensembl-Tr; ENST00000394986; homo_sapiens.
DR   Ensembl-Tr; ENST00000394991; homo_sapiens.
DR   Ensembl-Tr; ENST00000420646; homo_sapiens.
DR   Ensembl-Tr; ENST00000502987; homo_sapiens.
DR   Ensembl-Tr; ENST00000506244; homo_sapiens.
DR   Ensembl-Tr; ENST00000508895; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..511
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /collection_date="Feb-2007"
FT                   /clone="asynex1"
FT                   /cell_type="dendritic cells"
FT                   /db_xref="taxon:9606"
FT   gene            1..>511
FT                   /gene="NACP"
FT   5'UTR           1..272
FT                   /gene="NACP"
FT                   /note="alternatively spliced"
FT   CDS             273..>511
FT                   /codon_start=1
FT                   /gene="NACP"
FT                   /product="synuclein alpha-140"
FT                   /note="SNCA; non-A4 component of amyloid precursor"
FT                   /db_xref="GOA:F6L6N6"
FT                   /db_xref="InterPro:IPR001058"
FT                   /db_xref="UniProtKB/TrEMBL:F6L6N6"
FT                   /protein_id="AEG20815.1"
FT                   /translation="MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTK
FT                   EGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQ"
XX
SQ   Sequence 511 BP; 135 A; 113 C; 188 G; 75 T; 0 other;
     ggagagccga ggagaaggag aaggaggagg actaggagga ggaggacggc gacgaccaga        60
     aggggcccaa gagagggggc gagcgaccga gcgccgcgac gcggaagtga ggtgcgtgcg       120
     ggctgcagcg cagaccccgg cccggcccct ccgagagcgt cctgggcgct ccctcacgcc       180
     ttgccttcaa gccttctgcc tttccaccct cgtgagcgga gaactgggag tggccattcg       240
     acgacagtgt ggtgtaaagg aattcattag ccatggatgt attcatgaaa ggactttcaa       300
     aggccaagga gggagttgtg gctgctgctg agaaaaccaa acagggtgtg gcagaagcag       360
     caggaaagac aaaagagggt gttctctatg taggctccaa aaccaaggag ggagtggtgc       420
     atggtgtggc aacagtggct gagaagacca aagagcaagt gacaaatgtt ggaggagcag       480
     tggtgacggg tgtgacagca gtagcccaga a                                      511
//


spacer
spacer