spacer

EBI Dbfetch

ID   HQ709174; SV 1; linear; mRNA; STD; HUM; 1404 BP.
XX
AC   HQ709174;
XX
DT   13-MAR-2011 (Rel. 108, Created)
DT   13-MAR-2011 (Rel. 108, Last updated, Version 1)
XX
DE   Homo sapiens thyroid hormone nuclear receptor alpha (NR1F1) mRNA, complete
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1404
RA   Kaighin V.A., Martin A.L., Aronstam R.S.;
RT   "Isolation of cDNA coding for putatively new variants of multiple human
RT   nuclear receptors";
RL   Unpublished.
XX
RN   [2]
RP   1-1404
RA   Kaighin V.A., Martin A.L., Aronstam R.S.;
RT   ;
RL   Submitted (15-DEC-2010) to the INSDC.
RL   Biological Sciences, Missouri University of Science and Technology, 105
RL   Shrenk Hall, 400 W. 11th St, Rolla, MO 65409, USA
XX
DR   MD5; 078e0a1ba465b3a39f3d2d66d28980f9.
DR   Ensembl-Gn; ENSG00000069667; homo_sapiens.
DR   Ensembl-Tr; ENST00000449337; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1404
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone="NR1F10000A"
FT                   /tissue_type="kidney"
FT                   /db_xref="taxon:9606"
FT   gene            1..1404
FT                   /gene="NR1F1"
FT   CDS             1..1404
FT                   /codon_start=1
FT                   /gene="NR1F1"
FT                   /product="thyroid hormone nuclear receptor alpha"
FT                   /note="putative new variant; variant may be generated by
FT                   alternative splicing"
FT                   /db_xref="GOA:F1DAL0"
FT                   /db_xref="H-InvDB:HIT000653720.2"
FT                   /db_xref="InterPro:IPR000536"
FT                   /db_xref="InterPro:IPR001628"
FT                   /db_xref="InterPro:IPR001723"
FT                   /db_xref="InterPro:IPR003079"
FT                   /db_xref="InterPro:IPR008946"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/TrEMBL:F1DAL0"
FT                   /protein_id="ADZ17381.1"
FT                   /translation="MMYFVIAAMKAQIEIIPCKICGDKSSGIHYGVITCEGCKGFFRRS
FT                   QQSNATYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMSRDAVKFGRMSKKQRDSLYAE
FT                   VQKHRMQQQQRDHQQQPGEAEPLTPTYNISANGLTELHDDLSNYIDGHTPEGSKADSAV
FT                   SSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFPYCSFTNGETSPTVSMAELEHLA
FT                   QNISKSHLETCQYLREELQQITWQTFLQEEIENYQNKREVMWQLCAIKITEAIQYVVEF
FT                   AKRIDGFMELCQNDQIVLLKAGSLEVVFIRMCRAFDSQNNTVYFDGKYASPDVFKSLGC
FT                   EDFISFVFEFGKSLCSMHLTEDEIALFSAFVLMSADRSWLQEKVKIEKLQQKIQLALQH
FT                   VLQKNHREDGILTKLICKVSTLRALCGRHTEKLMAFKAIYPDIVRLHFPPLYKELFTSE
FT                   FEPAMQIDG"
XX
SQ   Sequence 1404 BP; 435 A; 308 C; 316 G; 345 T; 0 other;
     atgatgtatt ttgtgatcgc agcgatgaaa gctcaaattg aaattattcc atgcaagatc        60
     tgtggagaca aatcatcagg aatccattat ggtgtcatta catgtgaagg ctgcaagggc       120
     tttttcagga gaagtcagca aagcaatgcc acctactcct gtcctcgtca gaagaactgt       180
     ttgattgatc gaaccagtag aaaccgctgc caacactgtc gattacagaa atgccttgcc       240
     gtagggatgt ctcgagatgc tgtaaaattt ggccgaatgt caaaaaagca gagagacagc       300
     ttgtatgcag aagtacagaa acaccggatg cagcagcagc agcgcgacca ccagcagcag       360
     cctggagagg ctgagccgct gacgcccacc tacaacatct cggccaacgg gctgacggaa       420
     cttcacgacg acctcagtaa ctacattgac gggcacaccc ctgaggggag taaggcagac       480
     tccgccgtca gcagcttcta cctggacata cagccttccc cagaccagtc aggtcttgat       540
     atcaatggaa tcaaaccaga accaatatgt gactacacac cagcatcagg cttctttccc       600
     tactgttcgt tcaccaacgg cgagacttcc ccaactgtgt ccatggcaga attagaacac       660
     cttgcacaga atatatctaa atcgcatctg gaaacctgcc aatacttgag agaagagctc       720
     cagcagataa cgtggcagac ctttttacag gaagaaattg agaactatca aaacaagcgg       780
     gaggtgatgt ggcaattgtg tgccatcaaa attacagaag ctatacagta tgtggtggag       840
     tttgccaaac gcattgatgg atttatggaa ctgtgtcaaa atgatcaaat tgtgcttcta       900
     aaagcaggtt ctctagaggt ggtgtttatc agaatgtgcc gtgcctttga ctctcagaac       960
     aacaccgtgt actttgatgg gaagtatgcc agccccgacg tcttcaaatc cttaggttgt      1020
     gaagacttta ttagctttgt gtttgaattt ggaaagagtt tatgttctat gcacctgact      1080
     gaagatgaaa ttgcattatt ttctgcattt gtactgatgt cagcagatcg ctcatggctg      1140
     caagaaaagg taaaaattga aaaactgcaa cagaaaattc agctagctct tcaacacgtc      1200
     ctacagaaga atcaccgaga agatggaata ctaacaaagt taatatgcaa ggtgtctaca      1260
     ttaagagcct tatgtggacg acatacagaa aagctaatgg catttaaagc aatataccca      1320
     gacattgtgc gacttcattt tcctccatta tacaaggagt tgttcacttc agaatttgag      1380
     ccagcaatgc aaattgatgg gtaa                                             1404
//


spacer
spacer