Dbfetch

ID   HQ692818; SV 1; linear; mRNA; STD; HUM; 1407 BP.
XX
AC   HQ692818;
XX
DT   13-MAR-2011 (Rel. 108, Created)
DT   13-MAR-2011 (Rel. 108, Last updated, Version 1)
XX
DE   Homo sapiens thyroid hormone nuclear receptor alpha variant 4 (NR1F1) mRNA,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1407
RA   Kaighin V.A., Martin A.L., Aronstam R.S.;
RT   "Isolation of cDNA coding for multiple human nuclear receptor clones";
RL   Unpublished.
XX
RN   [2]
RP   1-1407
RA   Kaighin V.A., Martin A.L., Aronstam R.S.;
RT   ;
RL   Submitted (08-DEC-2010) to the INSDC.
RL   Biological Sciences, Missouri University of Science and Technology, 105
RL   Shrenk Hall, 400 W. 11th St, Rolla, MO 65409, USA
XX
DR   MD5; ff759c6e9d1f630f3dd729eacfa01a34.
DR   Ensembl-Gn; ENSG00000069667; homo_sapiens.
DR   Ensembl-Tr; ENST00000261523; homo_sapiens.
DR   Ensembl-Tr; ENST00000335670; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1407
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone="NR1F100004"
FT                   /tissue_type="kidney"
FT                   /db_xref="taxon:9606"
FT   gene            1..1407
FT                   /gene="NR1F1"
FT   CDS             1..1407
FT                   /codon_start=1
FT                   /gene="NR1F1"
FT                   /product="thyroid hormone nuclear receptor alpha variant 4"
FT                   /db_xref="GOA:P35398"
FT                   /db_xref="H-InvDB:HIT000653571.2"
FT                   /db_xref="HGNC:HGNC:10258"
FT                   /db_xref="InterPro:IPR000536"
FT                   /db_xref="InterPro:IPR001628"
FT                   /db_xref="InterPro:IPR001723"
FT                   /db_xref="InterPro:IPR003079"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="InterPro:IPR035500"
FT                   /db_xref="PDB:1N83"
FT                   /db_xref="PDB:1S0X"
FT                   /db_xref="PDB:4S15"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35398"
FT                   /protein_id="ADZ17329.1"
FT                   /translation="MMYFVIAAMKAQIEIIPCKICGDKSSGIHYGVITCEGCKGFFRRS
FT                   QQSNATYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMSRDAVKFGRMSKKQRDSLYAE
FT                   VQKHRMQQQQRDHQQQPGEAEPLTPTYNISANGLTELHDDLSNYIDGHTPEGSKADSAV
FT                   SSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFPYCSFTNGETSPTVSMAELEHLA
FT                   QNISKSHLETCQYLREELQQITWQTFLQEEIENYQNKQREVMWQLCAIKITEAIQYVVE
FT                   FAKRIDGFMELCQNDQIVLLKAGSLEVVFIRMCRAFDSQNNTVYFDGKYASPDVFKSLG
FT                   CEDFISFVFEFGKSLCSMHLTEDEIALFSAFVLMSADRSWLQEKVKIEKLQQKIQLALQ
FT                   HVLQKNHREDGILTKLICKVSTLRALCGRHTEKLMAFKAIYPDIVRLHFPPLYKELFTS
FT                   EFEPAMQIDG"
XX
SQ   Sequence 1407 BP; 436 A; 309 C; 317 G; 345 T; 0 other;
     atgatgtatt ttgtgatcgc agcgatgaaa gctcaaattg aaattattcc atgcaagatc        60
     tgtggagaca aatcatcagg aatccattat ggtgtcatta catgtgaagg ctgcaagggc       120
     tttttcagga gaagtcagca aagcaatgcc acctactcct gtcctcgtca gaagaactgt       180
     ttgattgatc gaaccagtag aaaccgctgc caacactgtc gattacagaa atgccttgcc       240
     gtagggatgt ctcgagatgc tgtaaaattt ggccgaatgt caaaaaagca gagagacagc       300
     ttgtatgcag aagtacagaa acaccggatg cagcagcagc agcgcgacca ccagcagcag       360
     cctggagagg ctgagccgct gacgcccacc tacaacatct cggccaacgg gctgacggaa       420
     cttcacgacg acctcagtaa ctacattgac gggcacaccc ctgaggggag taaggcagac       480
     tccgccgtca gcagcttcta cctggacata cagccttccc cagaccagtc aggtcttgat       540
     atcaatggaa tcaaaccaga accaatatgt gactacacac cagcatcagg cttctttccc       600
     tactgttcgt tcaccaacgg cgagacttcc ccaactgtgt ccatggcaga attagaacac       660
     cttgcacaga atatatctaa atcgcatctg gaaacctgcc aatacttgag agaagagctc       720
     cagcagataa cgtggcagac ctttttacag gaagaaattg agaactatca aaacaagcag       780
     cgggaggtga tgtggcaatt gtgtgccatc aaaattacag aagctataca gtatgtggtg       840
     gagtttgcca aacgcattga tggatttatg gaactgtgtc aaaatgatca aattgtgctt       900
     ctaaaagcag gttctctaga ggtggtgttt atcagaatgt gccgtgcctt tgactctcag       960
     aacaacaccg tgtactttga tgggaagtat gccagccccg acgtcttcaa atccttaggt      1020
     tgtgaagact ttattagctt tgtgtttgaa tttggaaaga gtttatgttc tatgcacctg      1080
     actgaagatg aaattgcatt attttctgca tttgtactga tgtcagcaga tcgctcatgg      1140
     ctgcaagaaa aggtaaaaat tgaaaaactg caacagaaaa ttcagctagc tcttcaacac      1200
     gtcctacaga agaatcaccg agaagatgga atactaacaa agttaatatg caaggtgtct      1260
     acattaagag ccttatgtgg acgacataca gaaaagctaa tggcatttaa agcaatatac      1320
     ccagacattg tgcgacttca ttttcctcca ttatacaagg agttgttcac ttcagaattt      1380
     gagccagcaa tgcaaattga tgggtaa                                          1407
//