spacer

EBI Dbfetch

ID   HQ405764; SV 1; linear; mRNA; STD; MUS; 422 BP.
XX
AC   HQ405764;
XX
DT   26-JUN-2011 (Rel. 109, Created)
DT   04-SEP-2011 (Rel. 110, Last updated, Version 2)
XX
DE   Mus musculus SH3 and multiple ankyrin repeat domains-like protein 3 variant
DE   1 (Shank3) mRNA, partial cds, alternatively spliced.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-422
RX   DOI; 10.1093/hmg/ddr212.
RX   PUBMED; 21558424.
RA   Wang X., McCoy P.A., Rodriguiz R.M., Pan Y., Je H.S., Roberts A.C.,
RA   Kim C.J., Berrios J., Colvin J.S., Bousquet-Moore D., Lorenzo I., Wu G.,
RA   Weinberg R.J., Ehlers M.D., Philpot B.D., Beaudet A.L., Wetsel W.C.,
RA   Jiang Y.H.;
RT   "Synaptic dysfunction and abnormal behaviors in mice lacking major isoforms
RT   of Shank3";
RL   Hum. Mol. Genet. 20(15):3093-3108(2011).
XX
RN   [2]
RP   1-422
RA   Wang X., Jiang Y.-H.;
RT   ;
RL   Submitted (14-OCT-2010) to the INSDC.
RL   Department of Pediatrics, Duke University, 595 LaSalle Street, Durham, NC
RL   27710, USA
XX
DR   MD5; 2996ac266adbf9180984be98c0226a3e.
DR   Ensembl-Gn; ENSMUSG00000022623; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000039074; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066545; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109309; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..422
FT                   /organism="Mus musculus"
FT                   /chromosome="15"
FT                   /map="15q"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   gene            <1..>422
FT                   /gene="Shank3"
FT   CDS             <1..>422
FT                   /codon_start=2
FT                   /gene="Shank3"
FT                   /product="SH3 and multiple ankyrin repeat domains-like
FT                   protein 3 variant 1"
FT                   /note="SPANK-2; proSAP2; proline-rich synapse-associated
FT                   protein 2; alternatively spliced"
FT                   /db_xref="GOA:F8S0X7"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR011511"
FT                   /db_xref="MGI:MGI:1930016"
FT                   /db_xref="UniProtKB/TrEMBL:F8S0X7"
FT                   /protein_id="AEB77771.1"
FT                   /translation="ELENDISGPSAGRGGHNKISPSGPGGSGPKRKLYSAVPGRKFIAV
FT                   KAHSPQGEGEIPLHRGEAVKVLSIGEGGFWEGTVKGRTGWFPADCVEEVQMRQYDTRHE
FT                   TREDRTKRLFRHYTVGSYDSLTSHSDYVIDDKVAIL"
XX
SQ   Sequence 422 BP; 95 A; 120 C; 139 G; 68 T; 0 other;
     tgaactggag aatgacatca gcggcccctc agcaggcagg ggtggccaca acaagatcag        60
     ccccagtggg cccggcggat ccggcccgaa gcggaaactt tacagtgccg tccccggccg       120
     caagttcatc gctgtgaagg cgcacagccc gcagggcgag ggcgagatcc cgctgcaccg       180
     cggcgaggcc gtgaaggtgc tcagcattgg ggagggcggt ttctgggagg gaaccgtgaa       240
     gggccgaaca ggctggttcc cagctgactg tgtggaagaa gtgcagatgc gacagtatga       300
     cacccggcat gaaaccagag aggaccggac gaagcgtctc ttccgccact acactgtggg       360
     ttcctatgac agcctcactt cacacagcga ttatgtcatc gatgataagg tggctatcct       420
     gc                                                                      422
//


spacer
spacer