spacer

EBI Dbfetch

ID   HQ405763; SV 1; linear; mRNA; STD; MUS; 523 BP.
XX
AC   HQ405763;
XX
DT   26-JUN-2011 (Rel. 109, Created)
DT   04-SEP-2011 (Rel. 110, Last updated, Version 2)
XX
DE   Mus musculus SH3 and multiple ankyrin repeat domains-like protein 3 variant
DE   e-2 (Shank3) mRNA, partial cds, alternatively spliced.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-523
RX   DOI; 10.1093/hmg/ddr212.
RX   PUBMED; 21558424.
RA   Wang X., McCoy P.A., Rodriguiz R.M., Pan Y., Je H.S., Roberts A.C.,
RA   Kim C.J., Berrios J., Colvin J.S., Bousquet-Moore D., Lorenzo I., Wu G.,
RA   Weinberg R.J., Ehlers M.D., Philpot B.D., Beaudet A.L., Wetsel W.C.,
RA   Jiang Y.H.;
RT   "Synaptic dysfunction and abnormal behaviors in mice lacking major isoforms
RT   of Shank3";
RL   Hum. Mol. Genet. 20(15):3093-3108(2011).
XX
RN   [2]
RP   1-523
RA   Wang X., Jiang Y.-H.;
RT   ;
RL   Submitted (14-OCT-2010) to the INSDC.
RL   Department of Pediatrics, Duke University, 595 LaSalle Street, Durham, NC
RL   27710, USA
XX
DR   MD5; 61cadde59988f7099d1167806f78c187.
DR   Ensembl-Gn; ENSMUSG00000022623; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167173; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..523
FT                   /organism="Mus musculus"
FT                   /chromosome="15"
FT                   /map="15q"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   gene            1..>523
FT                   /gene="Shank3"
FT   5'UTR           1..244
FT                   /gene="Shank3"
FT   CDS             245..>523
FT                   /codon_start=1
FT                   /gene="Shank3"
FT                   /product="SH3 and multiple ankyrin repeat domains-like
FT                   protein 3 variant e-2"
FT                   /note="SPANK-2; proSAP2; proline-rich synapse-associated
FT                   protein 2; alternatively spliced"
FT                   /db_xref="GOA:Q4ACU6"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001660"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR011511"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR021129"
FT                   /db_xref="MGI:MGI:1930016"
FT                   /db_xref="PDB:3O5N"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ACU6"
FT                   /protein_id="AEB77770.1"
FT                   /translation="MKKFASSRSLNKILAQCDSSSREYEEVQAVERKWHLHLATPRRLL
FT                   LDRRAKASLFFAAPPPPKRAPSTTLTLRSKSMTAELEELEKLDEILAV"
XX
SQ   Sequence 523 BP; 100 A; 162 C; 156 G; 105 T; 0 other;
     gtacctgggt ctgggtgctt taggcggcag gaggtagcct ggcaggagat ctacccagcc        60
     cccatgggtg gtgcccactc actggggcct tggagcccgc agggtggatc ctcagagcag       120
     aaccagccag catcctagcc tttgctggtg cttttattac catttgaggc cttggtcctg       180
     ggagtctgaa gagccctagg ggcacaactg ccctggctcc actgctccct gagtgcctca       240
     cgccatgaag aagtttgcat ctagccgcag cctgaacaag atcttggcac agtgtgactc       300
     ctcttccaga gagtacgagg aggtccaggc agtggagcgc aagtggcatt tgcacctggc       360
     cactccgcgc cgcctgctgc tggaccggag ggccaaggcc tccctcttct ttgcagcccc       420
     accaccccca aagagggctc ccagcaccac gctgaccctg cggtccaagt ccatgacggc       480
     tgagctcgag gaacttgaga agttggatga gatcctggca gtt                         523
//


spacer
spacer