spacer

EBI Dbfetch

ID   HQ201306; SV 2; linear; mRNA; STD; HUM; 702 BP.
XX
AC   HQ201306;
XX
DT   17-JAN-2011 (Rel. 107, Created)
DT   04-MAY-2011 (Rel. 108, Last updated, Version 2)
XX
DE   Homo sapiens tumor necrosis factor-alpha mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-702
RA   Rajmani R.S., Tiwari A.K., Subudhi P., Ravi Kumar G., Sahoo A., Palia S.K.,
RA   Uttara C., Lovleen S., Shika S., Sangeeta T., Doley J., Singh P.K.;
RT   ;
RL   Submitted (30-AUG-2010) to the INSDC.
RL   Animal Biotechnology, IVRI, Izatnagar, Bareilly, UP 243122, India
XX
RN   [2]
RC   Sequence update by submitter
RP   1-702
RA   Rajmani R., Tiwari A., Ravi Kumar G., Sahoo A., Doley J., Singh P.,
RA   Rajiv K., Lovleen S., Shikha S., Chaturvedi U., Palia S., Tiwari S.;
RT   ;
RL   Submitted (03-MAY-2011) to the INSDC.
RL   Animal Biotechnology, Indian Veterinary Research Institute, Molecular
RL   Biology Lab, IVRI, Izatnagar, Bareilly, U.P. 243122, India
XX
DR   MD5; ce8a512c750211f43a7a67bb51d39b6a.
DR   Ensembl-Gn; ENSG00000204490; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206439; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223952; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228321; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228849; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230108; homo_sapiens.
DR   Ensembl-Gn; ENSG00000232810; homo_sapiens.
DR   Ensembl-Tr; ENST00000376122; homo_sapiens.
DR   Ensembl-Tr; ENST00000383496; homo_sapiens.
DR   Ensembl-Tr; ENST00000412275; homo_sapiens.
DR   Ensembl-Tr; ENST00000420425; homo_sapiens.
DR   Ensembl-Tr; ENST00000443707; homo_sapiens.
DR   Ensembl-Tr; ENST00000448781; homo_sapiens.
DR   Ensembl-Tr; ENST00000449264; homo_sapiens.
DR   H-InvDB; HIT000653185_02.2.
DR   H-InvDB; HIT000653185_03.2.
DR   H-InvDB; HIT000653185_04.2.
DR   H-InvDB; HIT000653185_05.2.
DR   H-InvDB; HIT000653185_06.2.
DR   H-InvDB; HIT000653185_07.2.
XX
CC   On May 3, 2011 this sequence version replaced gi:317513775.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..702
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS             1..702
FT                   /codon_start=1
FT                   /product="tumor necrosis factor-alpha"
FT                   /note="TNF superfamily member 2; TNF-alpha; HuTNF"
FT                   /db_xref="GOA:Q5STB3"
FT                   /db_xref="H-InvDB:HIT000653185_01.2"
FT                   /db_xref="InterPro:IPR002959"
FT                   /db_xref="InterPro:IPR006052"
FT                   /db_xref="InterPro:IPR006053"
FT                   /db_xref="InterPro:IPR008983"
FT                   /db_xref="InterPro:IPR021184"
FT                   /db_xref="UniProtKB/TrEMBL:Q5STB3"
FT                   /protein_id="ADV31546.2"
FT                   /translation="MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGAT
FT                   TLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQW
FT                   LNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSY
FT                   QTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAE
FT                   SGQVYFGIIAL"
XX
SQ   Sequence 702 BP; 136 A; 232 C; 198 G; 136 T; 0 other;
     atgagcactg aaagcatgat ccgggacgtg gagctggccg aggaggcgct ccccaagaag        60
     acaggggggc cccagggctc caggcggtgc ttgttcctca gcctcttctc cttcctgatc       120
     gtggcaggcg ccaccacgct cttctgcctg ctgcactttg gggtgatcgg cccccagagg       180
     gaagagttcc ccagggacct ctctctaatc agccctctgg cccaggcagt cagatcatct       240
     tctcgaaccc cgagtgacaa gcctgtagcc catgttgtag caaaccctca agctgagggg       300
     cagctccagt ggctgaaccg ccgggccaat gccctcctgg ccaatggcgt ggagctgaga       360
     gataaccagt tggtggtgcc atcagagggc ctgtacctca tctactccca ggtcctcttc       420
     aagggccaag gctgcccctc cacccatgtg ctcctcaccc acaccatcag ccgcatcgcc       480
     gtctcctacc agaccaaggt caacctcctc tctgccatca agagcccctg ccagagggag       540
     accccagagg gggctgaggc caagccctgg tatgagccca tctatctggg aggggtcttc       600
     cagctggaga agggtgaccg actcagcgct gagatcaatc ggcccgacta tctcgacttt       660
     gccgagtctg ggcaggtcta ctttgggatc attgccctgt ga                          702
//


spacer
spacer