spacer

EBI Dbfetch

ID   HM067861; SV 1; linear; mRNA; STD; HUM; 801 BP.
XX
AC   HM067861;
XX
DT   16-JUN-2010 (Rel. 105, Created)
DT   24-OCT-2011 (Rel. 110, Last updated, Version 2)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) mRNA, HLA-DRB1*15:01:01:01
DE   allele, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-801
RX   DOI; 10.1111/j.1399-0039.2010.01626.x.
RX   PUBMED; 21388356.
RA   Zhu F., He Y., Tao S., Zhang W., He J., He J., Xu X., Lv H., Yan L.;
RT   "Analysis of the complete cDNA sequences of HLA-DRB1 alleles with
RT   group-specific amplification primers in the Chinese Han population";
RL   Tissue Antigens 77(4):329-332(2011).
XX
RN   [2]
RP   1-801
RA   Zhu F.M., He Y.M., Yan L.X.;
RT   "Full length cDNA sequence of HLA-DRB1*15:01:01:01";
RL   Unpublished.
XX
RN   [3]
RP   1-801
RA   Zhu F.M., He Y.M., Yan L.X.;
RT   ;
RL   Submitted (07-APR-2010) to the INSDC.
RL   HLA Typing Laboratory, Transfusion Research Institute, Wulin Road 345,
RL   Hangzhou, Zhejiang 310006, China
XX
DR   MD5; 5a01e5aed2f9357bfc82c3355ff69e1d.
DR   Ensembl-Gn; ENSG00000196126; homo_sapiens.
DR   Ensembl-Tr; ENST00000360004; homo_sapiens.
DR   H-InvDB; HIT000649164_03.2.
DR   H-InvDB; HIT000649164_04.2.
DR   H-InvDB; HIT000649164_05.2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..801
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6q"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   gene            1..801
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*15:01:01:01"
FT   CDS             1..801
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*15:01:01:01"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:D7RIH8"
FT                   /db_xref="H-InvDB:HIT000649164_01.2"
FT                   /db_xref="IMGT/HLA:DRB1*15:01:01:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:D7RIH8"
FT                   /protein_id="ADI59573.1"
FT                   /translation="MVCLKLPGGSCMTALTVTLMVLSSPLALSGDTRPRFLWQPKRECH
FT                   FFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAV
FT                   DTYCRHNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLN
FT                   GQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSE
FT                   SAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS"
XX
SQ   Sequence 801 BP; 173 A; 207 C; 257 G; 164 T; 0 other;
     atggtgtgtc tgaagctccc tggaggctcc tgcatgacag cgctgacagt gacactgatg        60
     gtgctgagct ccccactggc tttgtctggg gacacccgac cacgtttcct gtggcagcct       120
     aagagggagt gtcatttctt caatgggacg gagcgggtgc ggttcctgga cagatacttc       180
     tataaccagg aggagtccgt gcgcttcgac agcgacgtgg gggagttccg ggcggtgacg       240
     gagctggggc ggcctgacgc tgagtactgg aacagccaga aggacatcct ggagcaggcg       300
     cgggccgcgg tggacaccta ctgcagacac aactacgggg ttgtggagag cttcacagtg       360
     cagcggcgag tccaacctaa ggtgactgta tatccttcaa agacccagcc cctgcagcac       420
     cacaacctcc tggtctgctc tgtgagtggt ttctatccag gcagcattga agtcaggtgg       480
     ttcctgaacg gccaggaaga gaaggctggg atggtgtcca caggcctgat ccagaatgga       540
     gactggacct tccagaccct ggtgatgctg gaaacagttc ctcgaagtgg agaggtttac       600
     acctgccaag tggagcaccc aagcgtgaca agccctctca cagtggaatg gagagcacgg       660
     tctgaatctg cacagagcaa gatgctgagt ggagtcgggg gctttgtgct gggcctgctc       720
     ttccttgggg ccgggctgtt catctacttc aggaatcaga aaggacactc tggacttcag       780
     ccaacaggat tcctgagctg a                                                 801
//


spacer
spacer