Dbfetch

ID   GU214027; SV 1; linear; mRNA; STD; MUS; 1302 BP.
XX
AC   GU214027;
XX
DT   23-DEC-2009 (Rel. 103, Created)
DT   25-JAN-2011 (Rel. 107, Last updated, Version 2)
XX
DE   Mus musculus nucleophosmin 1 mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1302
RX   DOI; 10.1038/onc.2010.404.
RX   PUBMED; 20802533.
RA   Olanich M.E., Moss B.L., Piwnica-Worms D., Townsend R.R., Weber J.D.;
RT   "Identification of FUSE-binding protein 1 as a regulatory mRNA-binding
RT   protein that represses nucleophosmin translation";
RL   Oncogene 30(1):77-86(2011).
XX
RN   [2]
RP   1-1302
RA   Olanich M.E., Moss B.L., Piwnica-Worms D.R., Townsend R.R., Weber J.D.;
RT   "FBP1 is a rapamycin-induced factor that represses nucleophosmin
RT   translation to control cell growth";
RL   Unpublished.
XX
RN   [3]
RP   1-1302
RA   Olanich M.E., Weber J.D.;
RT   ;
RL   Submitted (18-NOV-2009) to the INSDC.
RL   Internal Medicine, Washington University in St. Louis School of Medicine,
RL   660 S. Euclid Ave., Box 8069, Saint Louis, MO 63110, USA
XX
DR   MD5; ba7a035fed11c99881033047bfeebbe2.
DR   Ensembl-Gn; ENSMUSG00000057113; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018141; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0018114; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0018078; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018083; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018537; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017460; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0017869; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0017979; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_LPJ_G0018051; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017997; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018576; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017241; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017509; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000075641; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0028501; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0028468; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0028428; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0028447; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028947; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0027895; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0028169; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0028303; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_LPJ_T0028414; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0028269; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028979; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0027602; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0027748; mus_musculus_wsbeij.
DR   EuropePMC; PMC3190308; 20802533.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1302
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             102..980
FT                   /codon_start=1
FT                   /product="nucleophosmin 1"
FT                   /db_xref="GOA:Q5SQB7"
FT                   /db_xref="InterPro:IPR004301"
FT                   /db_xref="InterPro:IPR024057"
FT                   /db_xref="InterPro:IPR032569"
FT                   /db_xref="MGI:MGI:106184"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SQB7"
FT                   /protein_id="ADA57701.1"
FT                   /translation="MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLR
FT                   TVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKC
FT                   GSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKRSAPGGGNKVPQKKVKLDEDDE
FT                   DDDEDDEDDEDDDDDDFDEEETEEKVPVKKSVRDTPAKNAQKSNQNGKDLKPSTPRSKG
FT                   QESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEA
FT                   IQDLWQWRKSL"
XX
SQ   Sequence 1302 BP; 439 A; 222 C; 311 G; 330 T; 0 other;
     ctttccttgg cgtgattccg tcctgtgcgg ctgttctgtg gaacaggagg cagttgtttt        60
     ccgtccggct tcccccacac cgaagtgcgc gcctccacct catggaagac tcgatggata       120
     tggacatgag tcctcttagg cctcagaact accttttcgg ctgtgaacta aaggctgaca       180
     aagactatca ctttaaagtg gataatgatg aaaatgagca ccagttgtca ttaagaacgg       240
     tcagtttagg agcaggggca aaagatgagt tacacatcgt agaggcagaa gcaatgaact       300
     atgaaggcag tccaattaaa gtaacactgg caactttgaa aatgtctgta caaccaacag       360
     tttccctagg gggctttgaa attacaccac ctgtggtctt acggttgaag tgtggttcag       420
     ggcctgtgca cattagtgga cagcatctag tagctgtaga ggaagatgca gagtctgaag       480
     atgaagatga ggaggacgta aaactcttag gcatgtctgg aaagcgatct gctcctggag       540
     gtggtaacaa ggttccacag aaaaaagtaa aacttgatga agatgatgag gacgatgatg       600
     aggacgatga ggatgatgag gatgatgatg atgatgattt tgatgaagag gaaactgaag       660
     aaaaggtccc agtgaagaaa tctgtacgag ataccccagc caaaaatgca caaaaatcaa       720
     accaaaatgg aaaagactta aaaccatcaa caccgagatc aaagggtcaa gagtccttca       780
     aaaaacagga aaagactcct aaaacaccaa aaggacctag ttctgtagaa gacattaagg       840
     caaaaatgca agcaagtata gaaaaaggcg gttctcttcc caaagtggaa gccaagttca       900
     ttaattatgt gaagaattgt ttccggatga ctgaccagga ggctattcaa gatctctggc       960
     agtggaggaa atctctttaa gaaaagggtt taaacagttt gaaatattct gtcttcattt      1020
     ctgtaatagt taatatctgg ctgtcctttt tataatgcaa agtgagaact ttccctactg      1080
     tgtttgataa atgttgtcca ggttcacttg ccaagaatgt gttgtctaaa atgcctgttt      1140
     agttttcaag gatggaactc caccctttac ttggttttaa gtatgtatgg aatgttatga      1200
     taggacatag taatagtggt cagatgtgga aatggtaggg agacaaatat acatgtgaaa      1260
     taaactcagt attttaataa agtaaaaaaa aaaaaaaaaa aa                         1302
//