spacer

EBI Dbfetch

ID   GQ428776; SV 1; linear; mRNA; STD; MUS; 897 BP.
XX
AC   GQ428776;
XX
DT   10-SEP-2009 (Rel. 102, Created)
DT   10-SEP-2009 (Rel. 102, Last updated, Version 1)
XX
DE   Mus musculus strain Swiss Albino TDP-43 variant 5 mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-897
RA   Varghese D.S., Kumar P.G.;
RT   ;
RL   Submitted (30-JUL-2009) to the INSDC.
RL   Molecular Reproduction, Rajiv Gandhi Centre for Biotechnology, Thycaud PO,
RL   Poojappura, Trivandrum, Kerala 695014, India
XX
DR   MD5; a1a5528b2d5ea88e47ccb37606e1fdbd.
DR   Ensembl-Gn; ENSMUSG00000041459; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000045180; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165113; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..897
FT                   /organism="Mus musculus"
FT                   /strain="Swiss Albino"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             1..897
FT                   /codon_start=1
FT                   /product="TDP-43 variant 5"
FT                   /note="TAR-binding protein"
FT                   /db_xref="GOA:Q8BLD4"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="MGI:MGI:2387629"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BLD4"
FT                   /protein_id="ACV52543.1"
FT                   /translation="MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRN
FT                   PVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTS
FT                   DLIVLGLPWKTTEQDLKDYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMS
FT                   QRHMIDGRWCDCKLPNSKQSPDEPLRSRKVFVGRCTEDMTAEELQQFFCQYGEVVDVFI
FT                   PKPFRAFAFVTFADDKVAQSLCGEDLIIKGISVHISNAEPKHNSNRQLERSGRFGGNPV
FT                   HLISNVYGRSTSLKVVL"
XX
SQ   Sequence 897 BP; 270 A; 167 C; 226 G; 234 T; 0 other;
     atgtctgaat atattcgggt aacagaagat gagaacgatg aacccattga aataccatca        60
     gaagacgatg ggacggtgtt gctgtccaca gttacagccc agtttccagg ggcatgcggc       120
     ctgcgctacc ggaatcccgt gtctcagtgt atgagaggag tccgactggt ggaaggaatt       180
     ctgcatgccc cagatgctgg ctggggcaat ctggtatatg ttgtcaacta tcccaaagat       240
     aacaaaagga aaatggatga gacagatgct tcctctgcag tgaaagtgaa aagagcagtc       300
     cagaaaacat ctgacctcat agtgttgggt ctcccctgga aaacaactga gcaggatctg       360
     aaagactatt tcagtacttt tggagaggtt cttatggttc aggtcaagaa agatcttaaa       420
     actggtcact cgaaagggtt tggctttgtt cgatttacag aatatgaaac ccaagtgaaa       480
     gtaatgtcac aacgacatat gatagatggg cgatggtgtg actgtaaact tcccaactct       540
     aagcaaagcc cagacgagcc tttgagaagc agaaaggtgt ttgttggacg ttgtacagag       600
     gacatgactg ctgaagagct tcagcagttt ttctgtcagt atggagaagt ggtagatgtc       660
     ttcattccca aaccattcag agcttttgcc ttcgtcacct ttgcagatga taaggttgcc       720
     cagtctcttt gtggagagga tttgatcatt aaaggaatca gcgtgcatat atccaatgct       780
     gaacctaagc ataatagcaa tagacagtta gaaagaagtg gaagatttgg tggtaatcca       840
     gttcatctca tttcaaatgt ttatggaaga agcacttcat tgaaagtagt gctgtaa          897
//


spacer
spacer