Dbfetch

ID   GQ428775; SV 1; linear; mRNA; STD; MUS; 1245 BP.
XX
AC   GQ428775;
XX
DT   10-SEP-2009 (Rel. 102, Created)
DT   10-SEP-2009 (Rel. 102, Last updated, Version 1)
XX
DE   Mus musculus strain Swiss Albino TDP-43 variant 1 mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1245
RA   Varghese D.S., Kumar P.G.;
RT   ;
RL   Submitted (30-JUL-2009) to the INSDC.
RL   Molecular Reproduction, Rajiv Gandhi Centre for Biotechnology, Thycaud PO,
RL   Poojappura, Trivandrum, Kerala 695014, India
XX
DR   MD5; 087722622834e64092ba3793ab8449fa.
DR   Ensembl-Gn; ENSMUSG00000041459; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029129; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0029094; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0029042; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029110; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028831; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029559; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028244; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0028793; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0028942; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0028906; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0029032; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028933; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029591; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027964; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028324; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000084125; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069263; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0069327; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0069233; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069244; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0068913; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069740; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069381; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0068853; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0068989; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0068889; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0069076; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0068906; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0069924; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0068877; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0068077; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1245
FT                   /organism="Mus musculus"
FT                   /strain="Swiss Albino"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             1..1245
FT                   /codon_start=1
FT                   /product="TDP-43 variant 1"
FT                   /note="TAR-binding protein"
FT                   /db_xref="GOA:Q544R5"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="MGI:MGI:2387629"
FT                   /db_xref="UniProtKB/TrEMBL:Q544R5"
FT                   /protein_id="ACV52542.1"
FT                   /translation="MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRN
FT                   PVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTS
FT                   DLIVLGLPWKTTEQDLKDYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMS
FT                   QRHMIDGRWCDCKLPNSKQSPDEPLRSRKVFVGRCTEDMTAEELQQFFCQYGEVVDVFI
FT                   PKPFRAFAFVTFADDKVAQSLCGEDLIIKGISVHISNAEPKHNSNRQLERSGRFGGNPG
FT                   GFGNQGGFGNSRGGGAGLGNNQGGNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGML
FT                   ASQQNQSGPSGNNQSQGSMQREPNQAFGSGNNSYSGSNSGAPLGWGSASNAGSGSGFNG
FT                   GFGSSMDSKSSGWGM"
XX
SQ   Sequence 1245 BP; 343 A; 231 C; 358 G; 313 T; 0 other;
     atgtctgaat atattcgggt aacagaagat gagaacgatg aacccattga aataccatca        60
     gaagacgatg ggacggtgtt gctgtccaca gttacagccc agtttccagg ggcatgcggc       120
     ctgcgctacc ggaatcccgt gtctcagtgt atgagaggag tccgactggt ggaaggaatt       180
     ctgcatgccc cagatgctgg ctggggcaat ctggtatatg ttgtcaacta tcccaaagat       240
     aacaaaagga aaatggatga gacagatgct tcctctgcag tgaaagtgaa aagagcagtc       300
     cagaaaacat ctgacctcat agtgttgggt ctcccctgga aaacaacaga gcaggatctg       360
     aaagactatt tcagtacttt tggagaggtt cttatggttc aggtcaagaa agatcttaaa       420
     actggtcact cgaaagggtt tggctttgtt cgatttacag aatatgaaac ccaagtgaaa       480
     gtaatgtcac aacgacatat gatagatggg cgatggtgtg actgtaaact tcccaactct       540
     aagcaaagcc cagacgagcc tttgagaagc agaaaggtgt ttgttggacg ttgtacagag       600
     gacatgactg ctgaagagct tcagcagttt ttctgtcagt atggagaagt ggtagatgtc       660
     ttcattccca aaccattcag agcttttgcc ttcgtcacct ttgcagatga taaggttgcc       720
     cagtctcttt gtggagagga tttgatcatt aaaggaatca gcgtgcatat atccaatgct       780
     gaacctaagc ataatagcaa tagacagtta gaaagaagtg gaagatttgg tggtaatcca       840
     ggtggctttg ggaatcaggg tgggtttggt aacagtagag ggggtggagc tggcttggga       900
     aataaccagg gtggtaatat gggtggaggg atgaactttg gtgcttttag cattaaccca       960
     gcgatgatgg ctgcggctca ggcagcgttg cagagcagtt ggggtatgat gggcatgtta      1020
     gccagccagc agaaccagtc gggcccatct gggaataacc aaagccaggg cagcatgcag      1080
     agggaaccaa atcaggcttt tggttctgga aataattcct acagtggttc taattctggt      1140
     gccccccttg gttgggggtc agcatcaaat gcaggatcgg gcagtggttt taatgggggc      1200
     tttggctcga gcatggattc taagtcttct ggctggggaa tgtag                      1245
//