spacer

EBI Dbfetch

ID   FR873086; SV 1; linear; genomic DNA; STD; HUM; 652 BP.
XX
AC   FR873086;
XX
DT   21-JUN-2011 (Rel. 109, Created)
DT   21-JUN-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DQB1 gene for MHC class II antigen, allele
DE   HLA-DQB1*new, exons 2-3, isolate D10115720
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-652
RA   Qu J.;
RT   ;
RL   Submitted (03-JUN-2011) to the INSDC.
RL   Qu J., Bei Shan Industrial Zone, HealthCare Dep., Yantian District, Shenzh
RL   518083, CHINA.
XX
RN   [2]
RA   Qu J., Huang C., Li J., Chen H., Zheng Z., Yi X., Yang L., Wang J.;
RT   "Characterization of 700 novel alleles at the HLA-A, -B, C, DQB1 and -DRB1
RT   loci from Chinese Marrow Donor Program volunteer donors";
RL   Unpublished.
XX
DR   MD5; f6ad9da8c4f61d0dc437af3d18e33e0a.
DR   Ensembl-Gn; ENSG00000179344; homo_sapiens.
DR   Ensembl-Tr; ENST00000374943; homo_sapiens.
DR   Ensembl-Tr; ENST00000399079; homo_sapiens.
DR   Ensembl-Tr; ENST00000399084; homo_sapiens.
DR   Ensembl-Tr; ENST00000434651; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..652
FT                   /organism="Homo sapiens"
FT                   /isolate="D10115720"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..>652)
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:F8LFZ1"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:F8LFZ1"
FT                   /protein_id="CCB96519.1"
FT                   /translation="DFVFQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAV
FT                   TPQGRPDAEYWNSQKEVLEGTRAELDTVCRHNYEVAFRGILQRRVEPTVTISPSRTEAL
FT                   NHHNLLVCSVTDFYPGQIKVRWFRNDQEETAGVVSTPLIRNGDWTFQILVMLEMTPQRG
FT                   DVYTCHVEHPSLQSPITVEW"
FT   exon            1..270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*new"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..652
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*new"
FT                   /number=3
XX
SQ   Sequence 652 BP; 120 A; 153 C; 175 G; 104 T; 100 other;
     aggatttcgt gttccagttt aagggcatgt gctacttcac caacgggacg gagcgcgtgc        60
     gtcttgtgac cagatacatc tataaccgag aggagtacgc gcgcttcgac agcgacgtgg       120
     gggtgtaccg cgcggtgacg ccgcaggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggaagtcct ggaggggacc cgggcggagt tggacacggt gtgcagacac aactacgagg       240
     tggcgttccg cgggatcttg cagaggagag nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn tggagcccac agtgaccatc tccccatcca ggacagaggc cctcaaccac       420
     cacaacctgc tggtctgctc ggtgacagat ttctatccag gccagatcaa agtccggtgg       480
     tttcggaatg atcaggagga gacagccggc gttgtgtcca ccccccttat taggaatggt       540
     gactggactt tccagatcct ggtgatgctg gaaatgactc cccagcgtgg agatgtctac       600
     acctgccacg tggagcaccc cagcctccag agccccatca ctgtggagtg gc               652
//


spacer
spacer