spacer

EBI Dbfetch

ID   FM955270; SV 1; linear; genomic DNA; STD; HUM; 663 BP.
XX
AC   FM955270;
XX
DT   19-DEC-2008 (Rel. 98, Created)
DT   19-DEC-2008 (Rel. 98, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen,
DE   HLA-DRB1*150101var allele, exon 2
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-663
RA   Witter K.;
RT   ;
RL   Submitted (18-DEC-2008) to the INSDC.
RL   Witter K., University of Munich, Laboratory of Immunogenetics,
RL   Max-Lebsche-Platz 32, 81377 Munich, GERMANY.
XX
RN   [2]
RA   Witter K.;
RT   "Intron variation drops out HLA-DRB1*15 amplification";
RL   Unpublished.
XX
DR   MD5; 66a59df87fcd1d95bce34fa2b3c3d0ba.
DR   Ensembl-Gn; ENSG00000196126; homo_sapiens.
DR   Ensembl-Tr; ENST00000360004; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..663
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   intron          <1..333
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*150101var"
FT                   /number=1
FT   CDS             <334..>590
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*150101var"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presentation"
FT                   /db_xref="GOA:B7VU65"
FT                   /db_xref="IMGT/HLA:DRB1*15:01:01:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:B7VU65"
FT                   /protein_id="CAV31551.1"
FT                   /translation="RFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFT"
FT   exon            334..590
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*150101var"
FT                   /number=2
FT   intron          591..>663
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*150101var"
FT                   /number=2
XX
SQ   Sequence 663 BP; 106 A; 177 C; 258 G; 122 T; 0 other;
     ctttggggct cccaggagga ggcggcgcgg gctgcggtgc tgggcggatc ctcctccagc        60
     tcctgcttgg aggtctccag aacaggctgg aggcagggag ggggtcccaa aagcctgggg       120
     atgagaaggg gttttcccgc atggtccccc aggcccccgt tcgcctcagg aagacggagg       180
     atgagctcct gggctgcagg tggtgggcgt tgtgggtggg gccggttaag gttccagcgc       240
     ccgcaccccg ctcagggagc cccggatggt ggcgtcgctg tccgtgtctt ctcaggaggc       300
     cgccctgtga ccggatggtt cgtgtcccca cagcacgttt cctgtggcag cctaagaggg       360
     agtgtcattt cttcaatggg acggagcggg tgcggttcct ggacagatac ttctataacc       420
     aggaggagtc cgtgcgcttc gacagcgacg tgggggagtt ccgggcggtg acggagctgg       480
     ggcggcctga cgctgagtac tggaacagcc agaaggacat cctggagcag gcgcgggccg       540
     cggtggacac ctactgcaga cacaactacg gggttgtgga gagcttcaca gtgcagcggc       600
     gaggtgagca tggccgcggg cggggcctga gtccccgtga gctgggaatc tgagtgtgtg       660
     tgt                                                                     663
//


spacer
spacer