spacer

EBI Dbfetch

ID   FM196525; SV 1; linear; genomic DNA; STD; HUM; 652 BP.
XX
AC   FM196525;
XX
DT   30-JUL-2008 (Rel. 96, Created)
DT   30-JUL-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, HLA-DRB1*14new
DE   allele, exons 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-652
RA   Enczmann J.;
RT   ;
RL   Submitted (16-JUL-2008) to the INSDC.
RL   Enczmann J., ITZ, University Clinic Duesseldorf, Moorenstrasse 5, 40225
RL   Duesseldorf, NRW, GERMANY.
XX
RN   [2]
RA   Ogrzewalla K., Tillmann G., Scheibelhut N., Lauber J., Enczmann J.;
RT   "A novel HLA-DRB1*14 allele identified by sequence-based typing";
RL   Unpublished.
XX
DR   MD5; bfdd7a87a73ee6d3653415d1877f6059.
DR   Ensembl-Gn; ENSG00000196126; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228080; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000360004; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   Ensembl-Tr; ENST00000412634; homo_sapiens.
DR   Ensembl-Tr; ENST00000415796; homo_sapiens.
DR   Ensembl-Tr; ENST00000419393; homo_sapiens.
DR   Ensembl-Tr; ENST00000428566; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..652
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..270,371..>652)
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14new"
FT   CDS             join(<1..270,371..>652)
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q9GIY3"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*14:82"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /protein_id="CAQ86516.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRYLDRYFHNQEEFVRFDSDVGEYRAV
FT                   TELGRPAAEHWNSQKDLLERRRAEVDTYCRHNYGVVESFTVQRRVHPKVTVYPSKTQPL
FT                   QHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSG
FT                   EVYTCQVEHPSVTSPLTVEW"
FT   exon            <1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14new"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..>652
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14new"
FT                   /number=3
XX
SQ   Sequence 652 BP; 122 A; 139 C; 181 G; 110 T; 100 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggtacctgga cagatacttc cataaccagg aggagttcgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgctgc ggagcactgg aacagccaga       180
     aggacctcct ggagcggagg cgggccgagg tggacaccta ttgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn tccatcctaa ggtgactgtg tatccttcaa agacccagcc cctgcagcac       420
     cacaacctgc tggtctgttc tgtgagtggt ttctatccag gcagcattga agtcaggtgg       480
     ttccggaatg gccaggaaga gaagactggg gtggtgtcca caggcctgat ccacaatgga       540
     gactggacct tccagaccct ggtgatgctg gaaacagttc ctcggagtgg agaggtttac       600
     acctgccaag tggagcaccc aagcgtgaca agccctctca cagtggaatg ga               652
//


spacer
spacer