spacer

EBI Dbfetch

ID   FM178516; SV 1; linear; mRNA; STD; MUS; 1413 BP.
XX
AC   FM178516;
XX
DT   30-OCT-2008 (Rel. 97, Created)
DT   30-OCT-2008 (Rel. 97, Last updated, Version 1)
XX
DE   Mus musculus mRNA for 5-hydroxytryptamine receptor 7 (Htr7 gene), splice
DE   variant c
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1413
RA   Van Craenenbroeck K.;
RT   ;
RL   Submitted (01-JUL-2008) to the INSDC.
RL   Van Craenenbroeck K., Legest, Ghent University, K.L. Ledeganckstraat 35,
RL   9000 Gent, BELGIUM.
XX
RN   [2]
RX   DOI; 10.1016/j.gene.2008.08.011.
RX   PUBMED; 18793707.
RA   Gellynck E., Laenen K., Andressen K.W., Lintermans B., De Martelaere K.,
RA   Matthys A., Levy F.O., Haegeman G., Vanhoenacker P., Van Craenenbroeck K.;
RT   "Cloning, genomic organization and functionality of 5-HT(7) receptor splice
RT   variants from mouse brain";
RL   Gene 426(1-2):23-31(2008).
XX
DR   MD5; bd32bf8bd57a30244e4b2389ecb750c7.
DR   Ensembl-Gn; ENSMUSG00000024798; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099505; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1413
FT                   /organism="Mus musculus"
FT                   /strain="BALB/C"
FT                   /mol_type="mRNA"
FT                   /tissue_lib="brain"
FT                   /db_xref="taxon:10090"
FT   CDS             1..1413
FT                   /gene="Htr7"
FT                   /product="5-hydroxytryptamine receptor 7"
FT                   /note="splice variant c"
FT                   /db_xref="GOA:B6VJS3"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR001069"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:99841"
FT                   /db_xref="UniProtKB/TrEMBL:B6VJS3"
FT                   /protein_id="CAQ76702.1"
FT                   /translation="MMDVNSSGRPDLYGHLRSLILPEVGRRLQDLSPDGGAHSVVSSWM
FT                   PHLLSGFPEVTASPAPTWDAPPDNVSGCGEQINYGRVEKVVIGSILTLITLLTIAGNCL
FT                   VVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIA
FT                   MDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLF
FT                   GWAQNVNDDKVCLISQDFGYTIYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFSGF
FT                   PRVQPESVISLNGVVKLQKEVEECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFT
FT                   VCWLPFFLLSTARPFICGTSCSCIPLWVERTCLWLGYANSLINPFIYAFFNRDLRTTYR
FT                   SLLQCQYRNINRKLSAAGMHEALKLAERPERSEFVLMTGASGVQKALENLPWGNGVNTG
FT                   IKAVNSVALTKL"
XX
SQ   Sequence 1413 BP; 297 A; 404 C; 392 G; 320 T; 0 other;
     atgatggacg ttaacagcag cggccgcccc gacctctacg gccatctccg ctctctcatc        60
     ctgccggagg tggggcgcag gctgcaggac ctgagccccg acggtggcgc ccactcggtg       120
     gtgagctcct ggatgccgca cctgctgagc ggcttcccag aggtgacagc tagcccggcg       180
     cccacctggg acgcgccccc ggacaatgtc tccggctgcg gggagcagat caactatggc       240
     agagtcgaga aagttgtgat cggctccatc ctgacgctca tcacgctgct gacgatcgcg       300
     ggcaactgcc tggtggtgat ctcggtgtgc tttgtcaaga agctccgcca gccctccaac       360
     tacctgattg tgtccctggc gctggctgac ctctcggtgg ccgtggcggt catgcctttc       420
     gttagtgtca cggacctcat cgggggcaag tggatcttcg gccacttctt ctgcaacgtc       480
     ttcatcgcca tggacgtcat gtgctgcacg gcctcgatca tgaccctgtg cgtgatcagc       540
     atcgacaggt accttgggat caccaggccc ctcacgtacc ccgtgaggca gaatgggaaa       600
     tgtatggcca aaatgattct gtcggtctgg cttctctctg cctccatcac cttacctcct       660
     ctcttcggat gggctcagaa tgtgaacgat gacaaagtgt gcttgatcag ccaggatttt       720
     ggctacacga tctactccac cgcagtggcg ttttatatcc ccatgtcggt catgctgttc       780
     atgtactatc agatttacaa ggccgccagg aagagcgcag ccaaacacaa gttctcaggc       840
     ttcccacgcg tgcagccgga gagcgtcatc tccctgaatg gcgtggtgaa actccagaag       900
     gaggtggaag agtgtgcgaa cctttcgaga ctgctcaaac acgaaaggaa aaacatttcc       960
     atcttcaaga gggaacagaa agcagccact accttgggga tcatcgtggg agccttcacg      1020
     gtgtgctggc tgccgttttt cctcttgtcc acagcaaggc cctttatctg tggcacctcc      1080
     tgtagctgca tcccgctgtg ggtggagagg acatgtctgt ggctgggcta tgcaaactct      1140
     ctcattaacc cttttatata tgccttcttc aaccgggacc tgaggaccac ctatcgtagc      1200
     ctactccagt gccagtaccg gaatatcaac cggaagctct ctgctgcagg catgcacgaa      1260
     gccctgaaac ttgctgagag gcctgagaga agcgagtttg tgctaatgac tggagcctca      1320
     ggagtccaga aggcactgga gaatttacct tggggtaacg gagtgaatac agggataaaa      1380
     gctgtgaatt ctgttgcact gacaaaactg tga                                   1413
//


spacer
spacer