spacer

EBI Dbfetch

ID   FJ888507; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   FJ888507;
XX
DT   03-MAY-2010 (Rel. 104, Created)
DT   03-MAY-2010 (Rel. 104, Last updated, Version 1)
XX
DE   Homo sapiens MHC class II antigen (HLA-DR15) gene, HLA-DR15_444_00093
DE   allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Cereb N., Yang S.Y.;
RT   "New HLA alleles found by histogenetics";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Cereb N., Yang S.Y.;
RT   ;
RL   Submitted (03-APR-2009) to the INSDC.
RL   Histogenetics, 300 Executive Blvd, Ossining, NY 10562, USA
XX
DR   MD5; 7a0394972f99244677eadcc821d1d853.
DR   Ensembl-Gn; ENSG00000196126; homo_sapiens.
DR   Ensembl-Tr; ENST00000360004; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /clone="DR15_444_00093"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DR15"
FT                   /allele="HLA-DR15_444_00093"
FT   mRNA            <1..>270
FT                   /gene="HLA-DR15"
FT                   /allele="HLA-DR15_444_00093"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DR15"
FT                   /allele="HLA-DR15_444_00093"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:D6BPR2"
FT                   /db_xref="IMGT/HLA:DRB1*15:01:08"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:D6BPR2"
FT                   /protein_id="ACP40977.1"
FT                   /translation="RFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DR15"
FT                   /allele="HLA-DR15_444_00093"
FT                   /number=2
XX
SQ   Sequence 270 BP; 55 A; 67 C; 100 G; 48 T; 0 other;
     cacgtttcct gtggcagcct aagagggagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccagg aggagtccgt gcgcttcgac agcgacgtcg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgacgc tgagtactgg aacagccaga       180
     aggacatcct ggagcaggcg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer