Dbfetch

ID   FJ795028; SV 1; linear; mRNA; STD; HUM; 701 BP.
XX
AC   FJ795028;
XX
DT   06-APR-2009 (Rel. 100, Created)
DT   06-APR-2009 (Rel. 100, Last updated, Version 1)
XX
DE   Homo sapiens tumor necrosis factor alpha (TNF) mRNA, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-701
RA   Guan W.J., Ma Y.H., Yu L.L., Na R.S., Liu S.;
RT   ;
RL   Submitted (28-FEB-2009) to the INSDC.
RL   Academy of Agricultural Sciences, Institute of Animal Science, Quanmingyuan
RL   West, Beijing 100193, People's Republic of China
XX
DR   MD5; d00355976e61f251a27eb711afdf7ceb.
DR   H-InvDB; HIT000558924_02.4.
DR   H-InvDB; HIT000558924_03.4.
DR   H-InvDB; HIT000558924_04.4.
DR   H-InvDB; HIT000558924_05.4.
DR   H-InvDB; HIT000558924_06.4.
DR   H-InvDB; HIT000558924_07.4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..701
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /country="China"
FT                   /collection_date="2008"
FT                   /sex="male"
FT                   /tissue_type="placenta"
FT                   /db_xref="taxon:9606"
FT   gene            <1..701
FT                   /gene="TNF"
FT   CDS             <1..701
FT                   /codon_start=3
FT                   /gene="TNF"
FT                   /product="tumor necrosis factor alpha"
FT                   /note="APC1 protein"
FT                   /db_xref="GOA:C1K3N5"
FT                   /db_xref="H-InvDB:HIT000558924_01.4"
FT                   /db_xref="InterPro:IPR002959"
FT                   /db_xref="InterPro:IPR006052"
FT                   /db_xref="InterPro:IPR006053"
FT                   /db_xref="InterPro:IPR008983"
FT                   /db_xref="InterPro:IPR021184"
FT                   /db_xref="UniProtKB/TrEMBL:C1K3N5"
FT                   /protein_id="ACO37640.1"
FT                   /translation="STESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATT
FT                   LFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWL
FT                   NRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQ
FT                   TKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAES
FT                   GQVYFGIIAL"
XX
SQ   Sequence 701 BP; 136 A; 233 C; 197 G; 135 T; 0 other;
     tgagcactga aagcatgatc cgggacgtgg agctggccga ggaggcgctc cccaagaaga        60
     caggggggcc ccagggctcc aggcggtgct tgttcctcag cctcttctcc ttcctgatcg       120
     tggcaggcgc caccacgctc ttctgcctgc tgcactttgg agtgatcggc ccccagaggg       180
     aagagttccc cagggacctc tctctaatca gccctctggc ccaggcagtc agatcatctt       240
     ctcgaacccc gagtgacaag cctgtagccc atgttgtagc aaaccctcaa gctgaggggc       300
     agctccagtg gctgaaccgc cgggccaatg ccctcctggc caatggcgtg gagctgagag       360
     ataaccagct ggtggtgcca tcagagggcc tgtacctcat ctactcccag gtcctcttca       420
     agggccaagg ctgcccctcc acccatgtgc tcctcaccca caccatcagc cgcatcgccg       480
     tctcctacca gaccaaggtc aacctcctct ctgccatcaa gagcccctgc cagagggaga       540
     ccccagaggg ggctgaggcc aagccctggt atgagcccat ctatctggga ggggtcttcc       600
     agctggagaa gggtgaccga ctcagcgctg agatcaatcg gcccgactat ctcgactttg       660
     ccgagtctgg gcaggtctac tttgggatca ttgccctgtg a                           701
//