spacer

EBI Dbfetch

ID   FJ621493; SV 1; linear; mRNA; STD; MUS; 1011 BP.
XX
AC   FJ621493;
XX
DT   11-FEB-2009 (Rel. 99, Created)
DT   15-APR-2009 (Rel. 100, Last updated, Version 2)
XX
DE   Mus musculus mitochondrial protein lysine deacetylase (Sirt3) mRNA,
DE   complete cds; nuclear gene for mitochondrial product.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-1011
RX   DOI; 10.1371/journal.pone.0004986.
RX   PUBMED; 19333382.
RA   Cooper H.M., Huang J.Y., Verdin E., Spelbrink J.N.;
RT   "A new splice variant of the mouse SIRT3 gene encodes the mitochondrial
RT   precursor protein";
RL   PLoS One 4(3):E4986-E4986(2009).
XX
RN   [2]
RP   1-1011
RA   Cooper H.M., Huang J.-Y., Verdin E., Spelbrink J.N.;
RT   ;
RL   Submitted (13-JAN-2009) to the INSDC.
RL   Molecular Cell Biology, Institute of Medical Technology, University of
RL   Tampere, Biokatu 6, Tampere, pir 33014, Finland
XX
DR   MD5; 7a118cace6c97d616f253843f92b54dd.
DR   Ensembl-Gn; ENSMUSG00000025486; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000147331; mus_musculus.
DR   EuropePMC; PMC2659428; 19333382.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1011
FT                   /organism="Mus musculus"
FT                   /chromosome="7"
FT                   /map="7F4"
FT                   /strain="NIH Swiss"
FT                   /mol_type="mRNA"
FT                   /cell_line="3T3"
FT                   /db_xref="taxon:10090"
FT   gene            1..1011
FT                   /gene="Sirt3"
FT   CDS             7..1011
FT                   /codon_start=1
FT                   /gene="Sirt3"
FT                   /product="mitochondrial protein lysine deacetylase"
FT                   /note="sirtuin 3; similar to yeast Sir2 protein"
FT                   /db_xref="GOA:Q8R104"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR017328"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="MGI:MGI:1927665"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R104"
FT                   /protein_id="ACM68947.1"
FT                   /translation="MALDPLGAVVLQSIMALSGRLALAALRLWGPGGGRRPISLCVGAS
FT                   GGFGGGGSSEKKFSLQDVAELLRTRACSRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQ
FT                   QYDIPYPEAIFELGFFFHNPKPFFMLAKELYPGHYRPNVTHYFLRLLHDKELLLRLYTQ
FT                   NIDGLERASGIPASKLVEAHGTFVTATCTVCRRSFPGEDIWADVMADRVPRCPVCTGVV
FT                   KPDIVFFGEQLPARFLLHMADFALADLLLILGTSLEVEPFASLSEAVQKSVPRLLINRD
FT                   LVGPFVLSPRRKDVVQLGDVVHGVERLVDLLGWTQELLDLMQRERGKLDGQDR"
XX
SQ   Sequence 1011 BP; 204 A; 265 C; 309 G; 233 T; 0 other;
     attcggatgg cgcttgaccc tctaggcgcc gtcgtcctgc agagcatcat ggcgctaagc        60
     ggtcgactgg cattggccgc gctcagactg tggggtccgg gaggtgggag aaggcccata       120
     tccctctgtg tgggagcctc aggcggcttt ggaggtggag gaagcagtga gaagaagttt       180
     tctctgcagg atgtagctga gctgcttcgg accagagcct gcagtagggt ggtggtcatg       240
     gtgggggccg gcatcagcac acccagtggc atcccggact tcagatcccc agggagcggc       300
     ctctacagca accttcagca gtatgacatc ccgtaccctg aagccatctt tgaacttggc       360
     tttttctttc acaaccccaa gccctttttc atgttggcca aggagctgta ccctgggcac       420
     tacaggccca atgtcactca ctacttcctg aggctcctcc acgacaagga gctgcttctg       480
     cggctctata cacagaacat cgacgggctt gagagagcat ctgggatccc tgcctcaaag       540
     ctggttgaag cccacgggac ctttgtaaca gctacatgca cggtctgtcg aaggtccttc       600
     ccaggggaag acatatgggc tgatgtgatg gcggacaggg tgccccgctg ccctgtctgt       660
     actggcgttg tgaaacccga cattgtgttc tttggggagc agctgcctgc aaggttccta       720
     ctccatatgg ctgacttcgc tttggcagat ctgctactca ttcttgggac ctccctggag       780
     gtggagcctt ttgccagctt gtctgaagca gtacagaaat cagtgccccg actgctcatc       840
     aatcgagact tggtggggcc gttcgttctg agtcctcgaa ggaaagatgt ggtccagcta       900
     ggggatgtag ttcatggtgt ggaaaggctg gtggacctcc tggggtggac acaagaactg       960
     ctggatctta tgcagcggga acgtggcaag ctggatggac aggacagata a               1011
//


spacer
spacer