spacer

EBI Dbfetch

ID   FJ619060; SV 1; linear; mRNA; STD; MUS; 540 BP.
XX
AC   FJ619060;
XX
DT   04-MAY-2009 (Rel. 100, Created)
DT   29-JUL-2009 (Rel. 101, Last updated, Version 2)
XX
DE   Mus musculus strain 129/SvJxC57BL aromatase (Cyp19a1) mRNA, 5' UTR, exon
DE   1.3/PII and partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-540
RX   DOI; 10.1016/j.jsbmb.2009.03.010.
RX   PUBMED; 19500729.
RA   Chow J.D., Simpson E.R., Boon W.C.;
RT   "Alternative 5'-untranslated first exons of the mouse Cyp19A1 (aromatase)
RT   gene";
RL   J. Steroid Biochem. Mol. Biol. 115(3-5):115-125(2009).
XX
RN   [2]
RP   1-540
RA   Chow J.D.Y., Simpson E.R., Boon W.C.;
RT   ;
RL   Submitted (09-JAN-2009) to the INSDC.
RL   Sex Hormone Biology, Prince Henry's Institute, 246 Clayton Rd, Clayton, Vic
RL   3168, Australia
XX
DR   MD5; 616719d942964b0432c900cfcd17d1e0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..540
FT                   /organism="Mus musculus"
FT                   /chromosome="9"
FT                   /map="9A5.3"
FT                   /strain="129/SvJxC57BL"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   gene            1..>540
FT                   /gene="Cyp19a1"
FT   5'UTR           1..390
FT                   /gene="Cyp19a1"
FT   exon            1..375
FT                   /gene="Cyp19a1"
FT                   /number=1.3/PII
FT                   /note="gonad-specific; new variant"
FT   regulatory      376..377
FT                   /gene="Cyp19a1"
FT                   /regulatory_class="GC_signal"
FT   CDS             391..>540
FT                   /codon_start=1
FT                   /gene="Cyp19a1"
FT                   /product="aromatase"
FT                   /note="P450-arom"
FT                   /db_xref="GOA:C3UPC9"
FT                   /db_xref="MGI:MGI:88587"
FT                   /db_xref="UniProtKB/TrEMBL:C3UPC9"
FT                   /protein_id="ACP43529.1"
FT                   /translation="MFLEMLNPMQYNVTIMVPETVTVSAMPLLLIMGLLLLIWNCESSS
FT                   SIPGP"
XX
SQ   Sequence 540 BP; 135 A; 127 C; 111 G; 167 T; 0 other;
     aggttgttag acttgggtac gggagccttt tcctgctcat gatttgtttt gttaattgag        60
     tttgctttta ataaggagga ttgcctcagc aaatgctgct gatgaaatca cagcattgtg       120
     attgttcctc tggaatgaac ttcagagagt tgactctcaa ttgagcacgt cactctacta       180
     actcaagggc gagatgataa ggttctatca gaccaactgt tgaacagaac ctgagcctcc       240
     caaggtcatc cttgttttga cttgtaacca caaatttgtc ttgtctaagt gtccaatcac       300
     tataaaacaa aatgcccatc tctccaatcc agcacccttc caagtgacag gagccttttt       360
     tttttttctt ctgaggccaa atagcgcaag atgttcttgg aaatgctgaa ccccatgcag       420
     tataatgtca ccatcatggt cccggaaact gtgactgtca gtgccatgcc actcctgctg       480
     atcatgggcc tccttctcct gatttggaat tgtgagagct cgtcttcaat accaggtcct       540
//


spacer
spacer