spacer

EBI Dbfetch

ID   FJ619059; SV 1; linear; mRNA; STD; MUS; 204 BP.
XX
AC   FJ619059;
XX
DT   04-MAY-2009 (Rel. 100, Created)
DT   29-JUL-2009 (Rel. 101, Last updated, Version 2)
XX
DE   Mus musculus strain 129/SvJxC57BL aromatase (Cyp19a1) mRNA, 5' UTR, exon
DE   I.4 and partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-204
RX   DOI; 10.1016/j.jsbmb.2009.03.010.
RX   PUBMED; 19500729.
RA   Chow J.D., Simpson E.R., Boon W.C.;
RT   "Alternative 5'-untranslated first exons of the mouse Cyp19A1 (aromatase)
RT   gene";
RL   J. Steroid Biochem. Mol. Biol. 115(3-5):115-125(2009).
XX
RN   [2]
RP   1-204
RA   Chow J.D.Y., Simpson E.R., Boon W.C.;
RT   ;
RL   Submitted (09-JAN-2009) to the INSDC.
RL   Sex Hormone Biology, Prince Henry's Institute, 246 Clayton Rd, Clayton, Vic
RL   3168, Australia
XX
DR   MD5; 3527af829018f570fff1aa297d529532.
DR   Ensembl-Gn; ENSMUSG00000032274; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034811; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..204
FT                   /organism="Mus musculus"
FT                   /chromosome="9"
FT                   /map="9A5.3"
FT                   /strain="129/SvJxC57BL"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   gene            1..>204
FT                   /gene="Cyp19a1"
FT   5'UTR           1..54
FT                   /gene="Cyp19a1"
FT   exon            1..39
FT                   /gene="Cyp19a1"
FT                   /number=I.4
FT                   /note="gonadal fat-specific first exon"
FT   GC_signal       40..41
FT                   /gene="Cyp19a1"
FT   CDS             55..>204
FT                   /codon_start=1
FT                   /gene="Cyp19a1"
FT                   /product="aromatase"
FT                   /db_xref="GOA:C3UPC9"
FT                   /db_xref="MGI:MGI:88587"
FT                   /db_xref="UniProtKB/TrEMBL:C3UPC9"
FT                   /protein_id="ACP43528.1"
FT                   /translation="MFLEMLNPMQYNVTIMVPETVTVSAMPLLLIMGLLLLIWNCESSS
FT                   SIPGP"
XX
SQ   Sequence 204 BP; 45 A; 56 C; 48 G; 55 T; 0 other;
     tggccggagg tctttgttct ggtcagcaca ccaactcagg ccaaatagcg caagatgttc        60
     ttggaaatgc tgaaccccat gcagtataat gtcaccatca tggtcccgga aactgtgact       120
     gtcagtgcca tgccactcct gctgatcatg ggcctccttc tcctgatttg gaattgtgag       180
     agctcgtctt caataccagg tcct                                              204
//


spacer
spacer