spacer

EBI Dbfetch

ID   FJ619058; SV 1; linear; mRNA; STD; MUS; 373 BP.
XX
AC   FJ619058;
XX
DT   04-MAY-2009 (Rel. 100, Created)
DT   29-JUL-2009 (Rel. 101, Last updated, Version 2)
XX
DE   Mus musculus strain 129/SvJxC57BL aromatase (Cyp19a1) mRNA, 5' UTR,
DE   testis-specific exon I and partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-373
RX   DOI; 10.1016/j.jsbmb.2009.03.010.
RX   PUBMED; 19500729.
RA   Chow J.D., Simpson E.R., Boon W.C.;
RT   "Alternative 5'-untranslated first exons of the mouse Cyp19A1 (aromatase)
RT   gene";
RL   J. Steroid Biochem. Mol. Biol. 115(3-5):115-125(2009).
XX
RN   [2]
RP   1-373
RA   Chow J.D.Y., Simpson E.R., Boon W.C.;
RT   ;
RL   Submitted (09-JAN-2009) to the INSDC.
RL   Sex Hormone Biology, Prince Henry's Institute, 246 Clayton Rd, Clayton, Vic
RL   3168, Australia
XX
DR   MD5; 0e5af5cbb145c093f4cba984b092a809.
DR   Ensembl-Gn; ENSMUSG00000032274; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034811; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..373
FT                   /organism="Mus musculus"
FT                   /chromosome="9"
FT                   /strain="129/SvJxC57BL"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   gene            1..>373
FT                   /gene="Cyp19a1"
FT   5'UTR           1..256
FT                   /gene="Cyp19a1"
FT   exon            1..241
FT                   /gene="Cyp19a1"
FT                   /number=I
FT                   /note="testis-specific"
FT   GC_signal       242..243
FT                   /gene="Cyp19a1"
FT   CDS             257..>373
FT                   /codon_start=1
FT                   /gene="Cyp19a1"
FT                   /product="aromatase"
FT                   /note="aromatizing enzyme"
FT                   /db_xref="GOA:C3UPC8"
FT                   /db_xref="MGI:MGI:88587"
FT                   /db_xref="UniProtKB/TrEMBL:C3UPC8"
FT                   /protein_id="ACP43527.1"
FT                   /translation="MFLEMLNPMQYNVTIMVPETVTVSAMPLLLIMGLLLLIW"
XX
SQ   Sequence 373 BP; 109 A; 80 C; 110 G; 74 T; 0 other;
     aggagaagga ggaaaaagga actcttgtag gtagagtgtt tttaggccag tgaggaactg        60
     actgtgagtg gaggtcactg atgagaccag ccaggatgtg tctgaaaccc ttacagacaa       120
     gtagaagcaa gaaacgggta taagtaaaac ggaaccagaa accatccagc cttaagtgtg       180
     ccggacaaag cgatggggaa agccggaggg gcatgcccgc gggttaccat ggggaacgaa       240
     ggccaaatag cgcaagatgt tcttggaaat gctgaacccc atgcagtata atgtcaccat       300
     catggtcccg gaaactgtga ctgtcagtgc catgccactc ctgctgatca tgggcctcct       360
     tctcctgatt tgg                                                          373
//


spacer
spacer