spacer

EBI Dbfetch

ID   FJ379259; SV 1; linear; genomic DNA; STD; HUM; 825 BP.
XX
AC   FJ379259;
XX
DT   04-NOV-2008 (Rel. 97, Created)
DT   29-SEP-2010 (Rel. 106, Last updated, Version 2)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*14:54 allele,
DE   exons 1 through 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-825
RX   DOI; 10.1016/j.humimm.2009.03.010.
RX   PUBMED; 19286445.
RA   Lee K.W., Jung Y.A.;
RT   "Additional sequence analysis outside exon 2 clarifies DRB1*12 and DRB1*14
RT   allelic frequencies in Koreans";
RL   Hum. Immunol. 70(6):464-467(2009).
XX
RN   [2]
RP   1-825
RA   Lee K.W.;
RT   ;
RL   Submitted (13-OCT-2008) to the INSDC.
RL   Hallym Institute for Genome Application, Hallym University, 896
RL   Pyungchon-Dong, Dongan-Gu, Anyang, Kyungki-Do 431-070, Korea
XX
DR   MD5; ef0461fb99b8ae78ccebced92bb717cd.
DR   Ensembl-Gn; ENSG00000196126; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228080; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000360004; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   Ensembl-Tr; ENST00000412634; homo_sapiens.
DR   Ensembl-Tr; ENST00000415796; homo_sapiens.
DR   Ensembl-Tr; ENST00000419393; homo_sapiens.
DR   Ensembl-Tr; ENST00000428566; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..825
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>825
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14:54"
FT   mRNA            join(<1..100,201..470,571..>825)
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14:54"
FT                   /product="MHC class II antigen"
FT   CDS             join(1..100,201..470,571..>825)
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14:54"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q9GIY3"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*14:54:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9GIY3"
FT                   /protein_id="ACJ06537.1"
FT                   /translation="MVCLRLPGGSCMAVLTVTLMVLSSPLALAGDTRPRFLEYSTSECH
FT                   FFNGTERVRFLDRYFHNQEEFVRFDSDVGEYRAVTELGRPAAEHWNSQKDLLERRRAEV
FT                   DTYCRHNYGVVESFTVQRRVHPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRN
FT                   GQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSGEVYTCQVEHPS"
FT   exon            <1..100
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14:54"
FT                   /number=1
FT   gap             101..200
FT                   /estimated_length=unknown
FT   exon            201..470
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14:54"
FT                   /number=2
FT   gap             471..570
FT                   /estimated_length=unknown
FT   exon            571..>825
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14:54"
FT                   /number=3
XX
SQ   Sequence 825 BP; 129 A; 159 C; 207 G; 130 T; 200 other;
     atggtgtgtc tgaggctccc tggaggctcc tgcatggcag ttctgacagt gacactgatg        60
     gtgctgagct ccccactggc tttggctggg gacaccagac nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       180
     nnnnnnnnnn nnnnnnnnnn cacgtttctt ggagtactct acgtctgagt gtcatttctt       240
     caatgggacg gagcgggtgc ggttcctgga cagatacttc cataaccagg aggagttcgt       300
     gcgcttcgac agcgacgtgg gggagtaccg ggcggtgacg gagctggggc ggcctgctgc       360
     ggagcactgg aacagccaga aggacctcct ggagcggagg cgggccgagg tggacaccta       420
     ttgcagacac aactacgggg ttgtggagag cttcacagtg cagcggcgag nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn tccatcctaa ggtgactgtg tatccttcaa       600
     agacccagcc cctgcagcac cacaacctgc tggtctgttc tgtgagtggt ttctatccag       660
     gcagcattga agtcaggtgg ttccggaatg gccaggaaga gaagactggg gtggtgtcca       720
     caggcctgat ccacaatgga gactggacct tccagaccct ggtgatgctg gaaacagttc       780
     ctcggagtgg agaggtttac acctgccaag tggagcaccc aagcg                       825
//


spacer
spacer