spacer

EBI Dbfetch

ID   FJ207423; SV 1; linear; mRNA; STD; MUS; 370 BP.
XX
AC   FJ207423;
XX
DT   03-JUN-2009 (Rel. 101, Created)
DT   03-JUN-2009 (Rel. 101, Last updated, Version 1)
XX
DE   Mus musculus ferroportin1 isoform FPN1B3 (Slc40a1) mRNA, partial cds,
DE   alternatively spliced.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-370
RX   DOI; 10.1016/j.cmet.2009.03.006.
RX   PUBMED; 19416716.
RA   Zhang D.L., Hughes R.M., Ollivierre-Wilson H., Ghosh M.C., Rouault T.A.;
RT   "A ferroportin transcript that lacks an iron-responsive element enables
RT   duodenal and erythroid precursor cells to evade translational repression";
RL   Cell Metab. 9(5):461-473(2009).
XX
RN   [2]
RP   1-370
RA   Zhang D.-L., Rouault T.A.;
RT   ;
RL   Submitted (10-SEP-2008) to the INSDC.
RL   Molecular Medicine Program, National Institute of Child Health and Human
RL   Development, 9000 Rockville Pike, Bethesda, MD 20892, USA
XX
DR   MD5; 7e4bd0af3716de4e4761cc50577cd756.
DR   Ensembl-Gn; ENSMUSG00000025993; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027137; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000186804; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000187406; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000187420; mus_musculus.
DR   EuropePMC; PMC2685206; 19416716.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..370
FT                   /organism="Mus musculus"
FT                   /strain="BALB/c"
FT                   /mol_type="mRNA"
FT                   /tissue_type="spleen"
FT                   /db_xref="taxon:10090"
FT   gene            1..>370
FT                   /gene="Slc40a1"
FT   5'UTR           1..160
FT                   /gene="Slc40a1"
FT   CDS             161..>370
FT                   /codon_start=1
FT                   /gene="Slc40a1"
FT                   /product="ferroportin1 isoform FPN1B3"
FT                   /note="alternatively spliced"
FT                   /db_xref="GOA:C5H8V4"
FT                   /db_xref="InterPro:IPR009716"
FT                   /db_xref="MGI:MGI:1315204"
FT                   /db_xref="UniProtKB/TrEMBL:C5H8V4"
FT                   /protein_id="ACO54856.1"
FT                   /translation="MTKARDQTHQEGCCGSLANYLTSAKFLLYLGHSLSTWGDRMWHFA
FT                   VSVFLVELYGNSLLLTAVYGLVVAG"
XX
SQ   Sequence 370 BP; 93 A; 89 C; 100 G; 88 T; 0 other;
     ttaccaggtg tcattctggc agggctggaa gagtgcaagc cggttggagt ttcaatgttt        60
     aggatcactc ttgaagtgtt gacaaacctg acaaagctcc cgggcaagag cagctaaagc       120
     taccagcatc agaacaaaca aggggagaac gcctggtgtc atgaccaagg caagagatca       180
     aacccatcag gaaggatgct gtggatcctt agcaaactac ctgacctcag caaaattcct       240
     cctctacctt ggccactctc tctccacttg gggggatcgg atgtggcact ttgcagtgtc       300
     tgtgtttctg gtggaactct atggaaacag ccttctcttg acagctgtct atggactggt       360
     ggtggcaggc                                                              370
//


spacer
spacer