spacer

EBI Dbfetch

ID   FJ207422; SV 1; linear; mRNA; STD; MUS; 408 BP.
XX
AC   FJ207422;
XX
DT   03-JUN-2009 (Rel. 101, Created)
DT   03-JUN-2009 (Rel. 101, Last updated, Version 1)
XX
DE   Mus musculus ferroportin1 isoform FPN1B2 (Slc40a1) mRNA, partial cds,
DE   alternatively spliced.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-408
RX   DOI; 10.1016/j.cmet.2009.03.006.
RX   PUBMED; 19416716.
RA   Zhang D.L., Hughes R.M., Ollivierre-Wilson H., Ghosh M.C., Rouault T.A.;
RT   "A ferroportin transcript that lacks an iron-responsive element enables
RT   duodenal and erythroid precursor cells to evade translational repression";
RL   Cell Metab. 9(5):461-473(2009).
XX
RN   [2]
RP   1-408
RA   Zhang D.-L., Rouault T.A.;
RT   ;
RL   Submitted (10-SEP-2008) to the INSDC.
RL   Molecular Medicine Program, National Institute of Child Health and Human
RL   Development, 9000 Rockville Pike, Bethesda, MD 20892, USA
XX
DR   MD5; f5cec554b66c336d2fdbcd8cac887598.
DR   Ensembl-Gn; ENSMUSG00000025993; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027137; mus_musculus.
DR   EuropePMC; PMC2685206; 19416716.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..408
FT                   /organism="Mus musculus"
FT                   /chromosome="1"
FT                   /map="1B"
FT                   /strain="BALB/c"
FT                   /mol_type="mRNA"
FT                   /tissue_type="spleen"
FT                   /db_xref="taxon:10090"
FT   gene            1..>408
FT                   /gene="Slc40a1"
FT   5'UTR           1..198
FT                   /gene="Slc40a1"
FT                   /note="transcribed from upstream promoter; lacks IRE (iron
FT                   responsive element)"
FT   CDS             199..>408
FT                   /codon_start=1
FT                   /gene="Slc40a1"
FT                   /product="ferroportin1 isoform FPN1B2"
FT                   /note="alternatively spliced"
FT                   /db_xref="GOA:C5H8V4"
FT                   /db_xref="InterPro:IPR009716"
FT                   /db_xref="MGI:MGI:1315204"
FT                   /db_xref="UniProtKB/TrEMBL:C5H8V4"
FT                   /protein_id="ACO54855.1"
FT                   /translation="MTKARDQTHQEGCCGSLANYLTSAKFLLYLGHSLSTWGDRMWHFA
FT                   VSVFLVELYGNSLLLTAVYGLVVAG"
XX
SQ   Sequence 408 BP; 99 A; 100 C; 108 G; 101 T; 0 other;
     ttaccaggtg tcattctggc agggctggaa gagtgcaagc cggttggagt ttcaatgttt        60
     aggatcactc ttgaagtgtt gacaaacctg acaaagtggt gctatcttcg gttcctctca       120
     ctcctgtgaa caagctcccg ggcaagagca gctaaagcta ccagcatcag aacaaacaag       180
     gggagaacgc ctggtgtcat gaccaaggca agagatcaaa cccatcagga aggatgctgt       240
     ggatccttag caaactacct gacctcagca aaattcctcc tctaccttgg ccactctctc       300
     tccacttggg gggatcggat gtggcacttt gcagtgtctg tgtttctggt ggaactctat       360
     ggaaacagcc ttctcttgac agctgtctat ggactggtgg tggcaggc                    408
//


spacer
spacer