spacer

EBI Dbfetch

ID   FJ207421; SV 1; linear; mRNA; STD; MUS; 451 BP.
XX
AC   FJ207421;
XX
DT   03-JUN-2009 (Rel. 101, Created)
DT   03-JUN-2009 (Rel. 101, Last updated, Version 1)
XX
DE   Mus musculus ferroportin1 isoform FPN1B1 (Slc40a1) mRNA, partial cds,
DE   alternatively spliced.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-451
RX   DOI; 10.1016/j.cmet.2009.03.006.
RX   PUBMED; 19416716.
RA   Zhang D.L., Hughes R.M., Ollivierre-Wilson H., Ghosh M.C., Rouault T.A.;
RT   "A ferroportin transcript that lacks an iron-responsive element enables
RT   duodenal and erythroid precursor cells to evade translational repression";
RL   Cell Metab. 9(5):461-473(2009).
XX
RN   [2]
RP   1-451
RA   Zhang D.-L., Rouault T.A.;
RT   ;
RL   Submitted (10-SEP-2008) to the INSDC.
RL   Molecular Medicine Program, National Institute of Child Health and Human
RL   Development, 9000 Rockville Pike, Bethesda, MD 20892, USA
XX
DR   MD5; fea4186fa6e84a6c3790b2e0d343262f.
DR   Ensembl-Gn; ENSMUSG00000025993; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027137; mus_musculus.
DR   EuropePMC; PMC2685206; 19416716.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..451
FT                   /organism="Mus musculus"
FT                   /chromosome="1"
FT                   /map="1B"
FT                   /strain="BALB/c"
FT                   /mol_type="mRNA"
FT                   /tissue_type="spleen"
FT                   /db_xref="taxon:10090"
FT   gene            1..>451
FT                   /gene="Slc40a1"
FT   5'UTR           1..241
FT                   /gene="Slc40a1"
FT                   /note="transcribed from upstream promoter; lacks IRE (iron
FT                   responsive element)"
FT   CDS             242..>451
FT                   /codon_start=1
FT                   /gene="Slc40a1"
FT                   /product="ferroportin1 isoform FPN1B1"
FT                   /note="alternatively spliced"
FT                   /db_xref="GOA:C5H8V4"
FT                   /db_xref="InterPro:IPR009716"
FT                   /db_xref="MGI:MGI:1315204"
FT                   /db_xref="UniProtKB/TrEMBL:C5H8V4"
FT                   /protein_id="ACO54854.1"
FT                   /translation="MTKARDQTHQEGCCGSLANYLTSAKFLLYLGHSLSTWGDRMWHFA
FT                   VSVFLVELYGNSLLLTAVYGLVVAG"
XX
SQ   Sequence 451 BP; 104 A; 108 C; 120 G; 119 T; 0 other;
     ttaccaggtg tcattctggc agggctggaa gagtgcaagc cggttggagt ttcaatgttt        60
     aggatcactc ttgaagtgtt gacaaacctg acaaagttgt cctttggggt ctttcggcat       120
     aaggctgttg tgcttatact ggtgctatct tcggttcctc tcactcctgt gaacaagctc       180
     ccgggcaaga gcagctaaag ctaccagcat cagaacaaac aaggggagaa cgcctggtgt       240
     catgaccaag gcaagagatc aaacccatca ggaaggatgc tgtggatcct tagcaaacta       300
     cctgacctca gcaaaattcc tcctctacct tggccactct ctctccactt ggggggatcg       360
     gatgtggcac tttgcagtgt ctgtgtttct ggtggaactc tatggaaaca gccttctctt       420
     gacagctgtc tatggactgg tggtggcagg c                                      451
//


spacer
spacer