Dbfetch

ID   EU826615; SV 1; linear; mRNA; STD; HUM; 468 BP.
XX
AC   EU826615;
XX
DT   23-JUL-2008 (Rel. 96, Created)
DT   23-JUL-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Homo sapiens soluble TNFR1B variant 1 (TNFR1B) mRNA, complete cds,
DE   alternatively spliced.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-468
RX   DOI; 10.1186/ar2447.
RX   PUBMED; 18593464.
RA   Jin P., Zhang J., Sumariwalla P.F., Ni I., Jorgensen B., Crawford D.,
RA   Phillips S., Feldmann M., Shepard H.M., Paleolog E.M.;
RT   "Novel splice variants derived from the receptor tyrosine kinase
RT   superfamily are potential therapeutics for rheumatoid arthritis";
RL   Arthritis Res. Ther. 10(4):R73-R73(2008).
XX
RN   [2]
RP   1-468
RA   Jin P., Zhang J., Ni I., Shepard H.M.;
RT   ;
RL   Submitted (16-JUN-2008) to the INSDC.
RL   Receptor Biologix, 3350 West Bayshore Road, Ste. 150, Palo Alto, CA 94303,
RL   USA
XX
DR   MD5; 419868c2feb480b5dcc814be11ad33cd.
DR   Ensembl-Gn; ENSG00000028137; homo_sapiens.
DR   Ensembl-Tr; ENST00000536782; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..468
FT                   /organism="Homo sapiens"
FT                   /chromosome="1"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   gene            1..468
FT                   /gene="TNFR1B"
FT   CDS             1..468
FT                   /codon_start=1
FT                   /gene="TNFR1B"
FT                   /product="soluble TNFR1B variant 1"
FT                   /note="alternatively spliced; extracellular domain"
FT                   /db_xref="H-InvDB:HIT000558200.4"
FT                   /db_xref="HGNC:HGNC:11917"
FT                   /db_xref="InterPro:IPR001368"
FT                   /db_xref="UniProtKB/TrEMBL:B5A977"
FT                   /protein_id="ACF47651.1"
FT                   /translation="MAPVAVWAALAVGLELWAAAHALPAQVAFTPYAPEPGSTCRLREY
FT                   YDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQ
FT                   VETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPDLS"
XX
SQ   Sequence 468 BP; 85 A; 157 C; 147 G; 79 T; 0 other;
     atggcgcccg tcgccgtctg ggccgcgctg gccgtcggac tggagctctg ggctgcggcg        60
     cacgccttgc ccgcccaggt ggcatttaca ccctacgccc cggagcccgg gagcacatgc       120
     cggctcagag aatactatga ccagacagct cagatgtgct gcagcaaatg ctcgccgggc       180
     caacatgcaa aagtcttctg taccaagacc tcggacaccg tgtgtgactc ctgtgaggac       240
     agcacataca cccagctctg gaactgggtt cccgagtgct tgagctgtgg ctcccgctgt       300
     agctctgacc aggtggaaac tcaagcctgc actcgggaac agaaccgcat ctgcacctgc       360
     aggcccggct ggtactgcgc gctgagcaag caggaggggt gccggctgtg cgcgccgctg       420
     cgcaagtgcc gcccgggctt cggcgtggcc agaccagacc tctcctag                    468
//