spacer

EBI Dbfetch

ID   EU446125; SV 1; linear; genomic DNA; STD; MUS; 892 BP.
XX
AC   EU446125;
XX
DT   27-FEB-2008 (Rel. 94, Created)
DT   27-FEB-2008 (Rel. 94, Last updated, Version 1)
XX
DE   Mus musculus delta 1 opioid receptor (Oprd1) gene, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-892
RA   Lesniak A., Sacharczuk M., Jaszczak K.;
RT   "Analysis of opioid receptor polymorphisms in high and low swim
RT   stress-induced analgesia mouse lines";
RL   Unpublished.
XX
RN   [2]
RP   1-892
RA   Lesniak A., Sacharczuk M., Jaszczak K.;
RT   ;
RL   Submitted (05-FEB-2008) to the INSDC.
RL   Department of Molecular Cytogenetics, Institute of Genetics and Animal
RL   Breeding, Polish Academy of Sciences, Postepu 1, Jastrzebiec, Wolka
RL   Kosowska 05-552, Poland
XX
DR   MD5; 783ff0cebc7c31a81ca1830fa0a2fe35.
DR   Ensembl-Gn; ENSMUSG00000050511; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056336; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..892
FT                   /organism="Mus musculus"
FT                   /strain="Swiss Webster"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            <1..>892
FT                   /gene="Oprd1"
FT                   /note="synonym: DOR-1"
FT   mRNA            <1..>892
FT                   /gene="Oprd1"
FT                   /product="delta 1 opioid receptor"
FT   CDS             <1..892
FT                   /codon_start=2
FT                   /gene="Oprd1"
FT                   /product="delta 1 opioid receptor"
FT                   /db_xref="GOA:B1ACW5"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000321"
FT                   /db_xref="InterPro:IPR001418"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:B1ACW5"
FT                   /protein_id="ACA23171.1"
FT                   /translation="YTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLC
FT                   KAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
FT                   VPIMVMAVTQPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLR
FT                   LRSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVA
FT                   ALHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRTPCGRQEPGSLRRPRQATTRERV
FT                   TACTPSDGPGGGAAA"
FT   variation       135
FT                   /gene="Oprd1"
FT                   /replace="t"
FT   variation       320
FT                   /gene="Oprd1"
FT                   /replace="t"
FT   variation       711
FT                   /gene="Oprd1"
FT                   /replace="g"
XX
SQ   Sequence 892 BP; 151 A; 299 C; 246 G; 196 T; 0 other;
     gtacaccaaa ttgaagaccg ccaccaacat ctacatcttc aatctggctt tggctgatgc        60
     gctggccacc agcacgctgc ccttccagag cgccaagtac ttgatggaaa cgtggccgtt       120
     tggcgagctg ctgtgcaagg ctgtgctctc cattgactac tacaacatgt tcactagcat       180
     cttcaccctc accatgatga gcgtggaccg ctacattgct gtctgccatc ctgtcaaagc       240
     cctggacttc cggacaccag ccaaggccaa gctgatcaat atatgcatct gggtcttggc       300
     ttcaggtgtc ggggtcccca tcatggtcat ggcagtgacc caaccccggg atggtgcagt       360
     ggtatgcatg ctccagttcc ccagtcccag ctggtactgg gacactgtga ccaagatctg       420
     cgtgttcctc tttgccttcg tggtgccgat cctcatcatc acggtgtgct atggcctcat       480
     gctactgcgc ctgcgcagcg tgcgtctgct gtccggttcc aaggagaagg accgcagcct       540
     gcggcgcatc acgcgcatgg tgctggtggt ggtgggcgcc ttcgtggtgt gctgggcgcc       600
     catccacatc ttcgtcatcg tctggacgct ggtggacatc aatcggcgcg acccacttgt       660
     ggtggccgca ctgcacctgt gcattgcgct gggctacgcc aacagcagcc tcaacccggt       720
     tctctacgcc ttcctggacg agaacttcaa gcgctgcttc cgccagctct gtcgcacgcc       780
     ctgcggccgc caagaacccg gcagtctccg tcgtccccgc caggccacca cgcgtgagcg       840
     tgtcactgcc tgcaccccct ccgacggccc gggcggtggc gctgccgcct ga               892
//


spacer
spacer