spacer

EBI Dbfetch

ID   EF524570; SV 1; linear; mRNA; STD; MUS; 978 BP.
XX
AC   EF524570;
XX
DT   19-SEP-2007 (Rel. 93, Created)
DT   19-SEP-2007 (Rel. 93, Last updated, Version 1)
XX
DE   Mus musculus galectin-8L mRNA, complete cds, alternatively spliced.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-978
RX   DOI; 10.1093/glycob/cwm104.
RX   PUBMED; 17893094.
RA   Tribulatti M.V., Mucci J., Cattaneo V., Aguero F., Gilmartin T., Head S.R.,
RA   Campetella O.;
RT   "Galectin-8 induces apoptosis in the CD4(high)CD8(high) thymocyte
RT   subpopulation";
RL   Glycobiology 17(12):1404-1412(2007).
XX
RN   [2]
RP   1-978
RA   Tribulatti M.V.;
RT   ;
RL   Submitted (27-MAR-2007) to the INSDC.
RL   Instituto de Investigaciones Biotecnologicas, Universidad Nacional de San
RL   Martin, Predio INTI, Edificio 24, San Martin, Buenos Aires B1650WAB,
RL   Argentina
XX
DR   MD5; 85c3f078bce49ed4f8086f0349b93eed.
DR   Ensembl-Gn; ENSMUSG00000057554; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000144283; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..978
FT                   /organism="Mus musculus"
FT                   /chromosome="13"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /tissue_type="thymus"
FT                   /db_xref="taxon:10090"
FT   CDS             1..978
FT                   /codon_start=1
FT                   /product="galectin-8L"
FT                   /note="long isoform; alternatively spliced"
FT                   /db_xref="GOA:A8DIL0"
FT                   /db_xref="InterPro:IPR001079"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="MGI:MGI:1928481"
FT                   /db_xref="UniProtKB/TrEMBL:A8DIL0"
FT                   /protein_id="ABS45108.1"
FT                   /translation="MLSLNNLQNIIYNPIIPYVGTITEQLKPGSLIVIRGHVPKDSERF
FT                   QVDFQLGNSLKPRADVAFHFNPRFKRSSCIVCNTLTQEKWGWEEITYDMPFRKEKSFEI
FT                   VFMVLKNKFQVAVNGRHVLLYAHRISPEQIDTVGIYGKVNIHSIGFRFSSASALPHTLG
FT                   DLQSMETSALGLTQINRENIQKPGKLQLSLPFEARLNASMGPGRTVVIKGEVNTNARSF
FT                   NVDLVAGKTRDIALHLNPRLNVKAFVRNSFLQDAWGEEERNITCFPFSSGMYFEMIIYC
FT                   DVREFKVAINGVHSLEYKHRFKDLSSIDTLSVDGDIRLLDVRSW"
FT   misc_feature    460..486
FT                   /note="alternative splicing of exon 4; Region: linker
FT                   peptide"
XX
SQ   Sequence 978 BP; 284 A; 218 C; 241 G; 235 T; 0 other;
     atgttgtcct taaataacct acaaaatatc atctataacc cgataatccc ctatgttggc        60
     accattactg agcaattgaa gcctggctct ctgattgtaa tccgtgggca tgtccctaaa       120
     gattcagaaa gattccaggt tgactttcag ctgggcaaca gcctgaagcc aagagcagac       180
     gtggccttcc actttaaccc tcggttcaaa aggtctagct gcattgtttg taacacactg       240
     acacaggaga agtggggctg ggaggagatc acctacgaca tgcccttcag aaaagaaaag       300
     tcctttgaga tcgtgttcat ggtgctcaag aacaaattcc aggtggctgt gaacggaagg       360
     catgttctgc tgtacgccca caggatcagc ccggagcaga tcgacacagt gggcatctac       420
     ggcaaagtga acatccactc catcgggttc agattcagct cggcaagtgc ccttccacac       480
     acactggggg atttacagag tatggaaaca tctgctctgg gactgacaca gataaacaga       540
     gagaatatac aaaagccagg caagctccag ctgagcctgc catttgaagc aaggttgaat       600
     gcctccatgg gtcctggacg aaccgttgtc attaaagggg aagtgaacac caatgcccga       660
     agctttaatg ttgacctagt ggcaggaaaa acaagggata tcgctctgca cttgaaccca       720
     cgcctcaatg tgaaagcatt tgtaagaaat tcctttcttc aggatgcctg gggagaagag       780
     gagagaaata ttacctgctt cccatttagt tctgggatgt actttgagat gataatctac       840
     tgtgatgtcc gggaattcaa ggttgctata aatggtgtgc acagcctgga gtacaaacac       900
     agatttaaag acctaagcag tattgataca ctatcagtcg atggtgatat ccgtttgctg       960
     gatgtaagga gctggtag                                                     978
//


spacer
spacer