spacer

EBI Dbfetch

ID   EF410152; SV 1; linear; genomic DNA; STD; MUS; 1443 BP.
XX
AC   EF410152;
XX
DT   27-FEB-2008 (Rel. 94, Created)
DT   27-FEB-2008 (Rel. 94, Last updated, Version 1)
XX
DE   Mus musculus type III neuregulin 1 (Nrg1) gene, exon 7 and partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1443
RA   Chen Y.-J.J., Johnson M.A., Lieberman M.D., Goodchild R., Rosoklija G.,
RA   Gingrich J.A., Moore H., Dwork A.J., Talmage D.A., Role L.W.;
RT   "Type III Nrg1 is required for normal sensorimotor gating, memory related
RT   behaviors and cortico-striatal circuit components";
RL   Unpublished.
XX
RN   [2]
RP   1-1443
RA   Chen Y.-J.J., Role L.W., Talmage D.A.;
RT   ;
RL   Submitted (30-JAN-2007) to the INSDC.
RL   Neurobiology and Behaviors, Columbia University, 1051 Riverside Drive, PO
RL   box 87, New York, NY 10032, USA
XX
DR   Ensembl-Gn; ENSMUSG00000062991; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000073884; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1443
FT                   /organism="Mus musculus"
FT                   /chromosome="8"
FT                   /strain="129/SvEv x C57BL/6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            1..>1443
FT                   /gene="Nrg1"
FT   mRNA            56..>1443
FT                   /gene="Nrg1"
FT                   /product="type III neuregulin 1"
FT   exon            56..1443
FT                   /gene="Nrg1"
FT                   /number=7
FT   misc_feature    62
FT                   /gene="Nrg1"
FT                   /note="alternative transcriptional start site"
FT   misc_feature    73
FT                   /gene="Nrg1"
FT                   /note="alternative transcriptional start site"
FT   misc_feature    185
FT                   /gene="Nrg1"
FT                   /note="alternative transcriptional start site"
FT   CDS             778..>1443
FT                   /codon_start=1
FT                   /gene="Nrg1"
FT                   /product="type III neuregulin 1"
FT                   /note="transmembrane protein; encodes cystein-rich domain;
FT                   contains exon 7"
FT                   /db_xref="GOA:B0YIS0"
FT                   /db_xref="UniProtKB/TrEMBL:B0YIS0"
FT                   /protein_id="ABN79386.1"
FT                   /translation="MEIYPPDMSEGAGGRSSSPSTQLSADPSLDGLPAAEHMPDTHTED
FT                   GRSPGLLGLAVPCCVCLEAERLRGCLNSEKICIVPILACLVSLCLCIAGLKWVFVDKIF
FT                   EYDSPTHLDPGGLGQDPVISLDPTAASAVLVSSEAYTSPVSKAQSEAEAHVTGQGDHVA
FT                   VASEPSAVPTRKNRLSAFPPLHSTPPPFPSPARTPEVRTPKSGTQPQTTETNLQTAPKL
FT                   "
XX
SQ   Sequence 1443 BP; 276 A; 402 C; 355 G; 410 T; 0 other;
     ttgcagagga aaaagtgact gagcgcaaga aggacaaaga ggagtggttg ggggtggggg        60
     tggaggcagg gcggggaagg gagttaccgc ccctcctggc tcctcctgcc ctcgcatcct       120
     tgtgcaatgg tactgtttgc cgtgatgctc agagggcagg cacctgctgc tctgtaatga       180
     ttcagcctct ttcagccgct gcgttaacac gacaggatgc tgttgctact gtcgctgctg       240
     cccctcctgc cgccgccgct gctgccgccg ccgcctcctc tggtcttgct tttgctttta       300
     cttctcctgc atgacagttg ttttcttcct ctaagcagac accagcttca gacgcttgag       360
     gtgagaaaca tgcctttcag tttgggatac tggtttactt aatcagctag gcatcagctt       420
     gcttcctctt ttggtcccct gccttcttga accaaccggg atggtttgga gaagcctttg       480
     aaagaactga aaaagtgtcc cagaaacaac agctcaagat atttcggtac acttctattt       540
     catagttgct agaagccctt tctttttcgt ttctttttct tttttttttt tctttttttt       600
     tttttttttt tttttatctt tttcttgctt cctcttaagc tctcttactt tggataatgg       660
     ccttggactt gggtgcctta tcgatttccc ccttcaagat gctgtatcat ttggttgggg       720
     ggagctctgc atggtaatgc actgtgagag aggccgggcc ttctggaggt gatccggatg       780
     gagatttatc ccccagacat gtctgaggga gctggcggga ggtcctccag cccctccact       840
     cagctgagtg cagacccatc tctcgatggg cttccggcag cggaacatat gccagacacc       900
     cacacagaag atgggagaag ccctggactc ctgggcctgg ccgtgccctg ctgtgtctgc       960
     ctggaagcgg agcgtctcag agggtgcctc aactccgaga agatctgcat tgttcccatt      1020
     ctggcttgtc tagtaagcct ctgcctctgc attgctggcc taaagtgggt atttgtggac      1080
     aagatattcg aatacgactc tcctacccac cttgaccctg gggggttagg ccaggaccct      1140
     gttatttctc tggatccaac ggctgcctcc gctgttctgg tctcatccga ggcatacact      1200
     tcacctgtct ctaaggctca gtctgaagct gaggctcatg ttacagggca aggtgaccat      1260
     gtcgctgtgg cctctgaacc ttccgcagta cccacccgga agaaccgact gtctgctttt      1320
     cctcccttac actccactcc accgcccttc ccttctccag ctcggacccc tgaggtgaga      1380
     acacccaagt caggaactca gccacaaaca acagaaacta atctgcaaac tgctcctaaa      1440
     ctt                                                                    1443
//


spacer
spacer