spacer

EBI Dbfetch

ID   EF199810; SV 1; linear; genomic DNA; STD; HUM; 425 BP.
XX
AC   EF199810;
XX
DT   29-JAN-2007 (Rel. 90, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*1113 variant
DE   allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-425
RX   DOI; 10.1111/j.1399-0039.2007.00835.x.
RX   PUBMED; 17498272.
RA   Abdeen H., McErlean C., Moraes M.E., Torres M., Campiotto S., Galvao S.,
RA   Gouvea C., Middleton D.;
RT   "Identification of three novel alleles of HLA-DRB1 and HLA-A in the
RT   Brazilian population";
RL   Tissue Antigens 69(6):607-610(2007).
XX
RN   [2]
RP   1-425
RA   Abdeen H., McErlean C., Moraes M.E., Middleton D.;
RT   ;
RL   Submitted (27-DEC-2006) to the INSDC.
RL   Northern Ireland Histocompatibility and Immunogenetics, Belfast City
RL   Hospital, Lisburn Road, Belfast BT9 7TS, UK
XX
DR   MD5; 394eb33027fa495daa3e5027cd57402a.
DR   Ensembl-Gn; ENSG00000196126; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228080; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000360004; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   Ensembl-Tr; ENST00000412634; homo_sapiens.
DR   Ensembl-Tr; ENST00000415796; homo_sapiens.
DR   Ensembl-Tr; ENST00000419393; homo_sapiens.
DR   Ensembl-Tr; ENST00000428566; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..425
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>425
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1113 variant"
FT   mRNA            <116..>385
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1113 variant"
FT   CDS             <116..>385
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1113 variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q9GIY3"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*14:65"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9GIY3"
FT                   /protein_id="ABM90423.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFHNQEEFVRFDSDVGEFRAV
FT                   TELGRPSAEYWNSQKDLLERRRAAVDTYCRHNYGVVESFTVQRR"
FT   exon            116..385
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1113 variant"
FT                   /number=2
XX
SQ   Sequence 425 BP; 71 A; 115 C; 156 G; 83 T; 0 other;
     gccggttaag gttcccagtg cctgcacccc gcccagggag ccccggatgg tggcgtcact        60
     gtcagtgtct tctcaggagg ccgcctgtgt gactggatcg ttcgtgtccc cacagcacgt       120
     ttcttggagt actctacgtc tgagtgtcat ttcttcaatg ggacggagcg ggtgcggttc       180
     ctggacagat acttccataa ccaggaggag ttcgtgcgct tcgacagcga cgtgggggag       240
     ttccgggcgg tgacggagct ggggcggcct agcgccgagt actggaacag ccagaaggac       300
     ctcctggagc ggaggcgggc cgcggtggac acctattgca gacacaacta cggggttgtg       360
     gagagcttca cagtgcagcg gcgaggtgag cgcggcgcgg ggcggggcct gagtccctgt       420
     gagct                                                                   425
//


spacer
spacer