Dbfetch

ID   DQ846748; SV 1; linear; mRNA; STD; MUS; 984 BP.
XX
AC   DQ846748;
XX
DT   01-JAN-2007 (Rel. 90, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus strain C57BL/6J Fas mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-984
RX   DOI; 10.1158/0008-5472.CAN-06-4006.
RX   PUBMED; 17545588.
RA   Villa-Morales M., Santos J., Perez-Gomez E., Quintanilla M.,
RA   Fernandez-Piqueras J.;
RT   "A role for the Fas/FasL system in modulating genetic susceptibility to
RT   T-cell lymphoblastic lymphomas";
RL   Cancer Res. 67(11):5107-5116(2007).
XX
RN   [2]
RP   1-984
RA   Villa-Morales M., Santos J., Fernandez-Piqueras J.;
RT   "Functional Fas cDNA polymorphisms in inbred strains exhibiting different
RT   susceptibility to gamma radiation-induced thymic lymphoma";
RL   Unpublished.
XX
RN   [3]
RP   1-984
RA   Villa-Morales M., Santos J., Fernandez-Piqueras J.;
RT   ;
RL   Submitted (10-JUL-2006) to the INSDC.
RL   Biology, Universidad Autonoma de Madrid, Campus de Cantoblanco, Carretera
RL   de Colmenar Viejo, KM 15, Madrid 28049, Spain
XX
DR   MD5; 69349e97e87ae5d86a87336bf2b3dcfd.
DR   Ensembl-Gn; ENSMUSG00000024778; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025056; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0025034; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0025000; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025030; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024789; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025471; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024259; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0024766; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0024898; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0024859; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0024984; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024890; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025529; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024323; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000025691; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051568; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0051587; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0051530; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051529; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051260; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052016; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051395; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0051202; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0051307; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0051262; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0051426; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051259; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052145; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050544; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..984
FT                   /organism="Mus musculus"
FT                   /chromosome="19"
FT                   /map="C3 band; 34.3 Mb"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             1..984
FT                   /codon_start=1
FT                   /product="Fas"
FT                   /note="TNF receptor superfamily member 6"
FT                   /db_xref="GOA:P25446"
FT                   /db_xref="InterPro:IPR000488"
FT                   /db_xref="InterPro:IPR001368"
FT                   /db_xref="InterPro:IPR008063"
FT                   /db_xref="InterPro:IPR011029"
FT                   /db_xref="InterPro:IPR033998"
FT                   /db_xref="InterPro:IPR033999"
FT                   /db_xref="MGI:MGI:95484"
FT                   /db_xref="PDB:2NA6"
FT                   /db_xref="PDB:3OQ9"
FT                   /db_xref="UniProtKB/Swiss-Prot:P25446"
FT                   /protein_id="ABI24112.1"
FT                   /translation="MLWIWAVLPLVLAGSQLRVHTQGTNSISESLKLRRRVRETDKNCS
FT                   EGLYQGGPFCCQPCQPGKKKVEDCKMNGGTPTCAPCTEGKEYMDKNHYADKCRRCTLCD
FT                   EEHGLEVETNCTLTQNTKCKCKPDFYCDSPGCEHCVRCASCEHGTLEPCTATSNTNCRK
FT                   QSPRNRLWLLTILVLLIPLVFIYRKYRKRKCWKRRQDDPESRTSSRETIPMNASNLSLS
FT                   KYIPRIAEDMTIQEAKKFARENNIKEGKIDEIMHDSIQDTAEQKVQLLLCWYQSHGKSD
FT                   AYQDLIKGLKKAECRRTLDKFQDMVQKDLGKSTPDTGNENEGQCLE"
XX
SQ   Sequence 984 BP; 327 A; 211 C; 233 G; 213 T; 0 other;
     atgctgtgga tctgggctgt cctgcctctg gtgcttgctg gctcacagtt aagagttcat        60
     actcaaggta ctaatagcat ctccgagagt ttaaagctga ggaggcgggt tcgtgaaact       120
     gataaaaact gctcagaagg attatatcaa ggaggcccat tttgctgtca accatgccaa       180
     cctggtaaaa aaaaagttga ggactgcaaa atgaatgggg gtacaccaac ctgcgcccca       240
     tgcacagaag ggaaggagta catggacaag aaccattatg ctgataaatg cagaagatgc       300
     acactctgcg atgaagagca tggtttagag gtggaaacaa actgcaccct gacccagaat       360
     accaagtgca agtgcaaacc agacttctac tgcgattctc ctggctgtga acactgtgtt       420
     cgctgcgcct cgtgtgaaca tggaaccctt gagccgtgca cagcaaccag caatacaaac       480
     tgcaggaaac aaagtcccag aaatcgccta tggttgttga ccatccttgt tttgttaatt       540
     ccacttgtat ttatatatcg aaagtaccgg aaaagaaagt gctggaaaag gagacaggat       600
     gaccctgaat ctagaacctc cagtcgtgaa accataccaa tgaatgcctc aaatcttagc       660
     ttgagtaaat acatcccgag aattgctgaa gacatgacaa tccaggaagc taaaaaattt       720
     gctcgagaaa ataacatcaa ggagggcaag atagatgaga tcatgcatga cagcatccaa       780
     gacacagctg agcagaaagt ccagctgctc ctgtgctggt accaatctca tgggaagagt       840
     gatgcatatc aagatttaat caagggtctc aaaaaagccg aatgtcgcag aaccttagat       900
     aaatttcagg acatggtcca gaaggacctt ggaaaatcaa ccccagacac tggaaatgaa       960
     aatgaaggac aatgtctgga gtga                                              984
//