spacer

EBI Dbfetch

ID   DQ504162; SV 1; linear; mRNA; STD; MUS; 2376 BP.
XX
AC   DQ504162;
XX
DT   02-OCT-2006 (Rel. 89, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus glucocorticoid receptor (Nr3c1) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2376
RX   PUBMED; 17012242.
RA   Xu D., Buehner A., Xu J., Lambert T., Nekl C., Nielsen M.K., Zhou Y.;
RT   "A polymorphic glucocorticoid receptor in a mouse population may explain
RT   inherited altered stress response and increased anxiety-type behaviors";
RL   FASEB J. 20(13):2414-2416(2006).
XX
RN   [2]
RP   1-2376
RA   Xu D., Xu J., Nielsen M.K., Zhou Y.;
RT   ;
RL   Submitted (19-APR-2006) to the INSDC.
RL   Vet. & Biomed. Sci., University of Nebraska-Lincoln, 1901 Vine St.,
RL   Lincoln, NE 68588-0665, USA
XX
DR   MD5; 9288014b7df264d08977e159f5035c98.
DR   Ensembl-Gn; ENSMUSG00000024431; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025300; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115567; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115571; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2376
FT                   /organism="Mus musculus"
FT                   /strain="outbred cross"
FT                   /mol_type="mRNA"
FT                   /note="Nebraska composite formed from four-way cross of
FT                   outbred stocks (CF-1, ICR, NIH and CFW(Sw))"
FT                   /db_xref="taxon:10090"
FT   gene            1..2376
FT                   /gene="Nr3c1"
FT   CDS             1..2376
FT                   /codon_start=1
FT                   /gene="Nr3c1"
FT                   /product="glucocorticoid receptor"
FT                   /note="nuclear receptor; polymorphic form"
FT                   /db_xref="GOA:Q06VW2"
FT                   /db_xref="InterPro:IPR000536"
FT                   /db_xref="InterPro:IPR001409"
FT                   /db_xref="InterPro:IPR001628"
FT                   /db_xref="InterPro:IPR001723"
FT                   /db_xref="InterPro:IPR008946"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="MGI:MGI:95824"
FT                   /db_xref="UniProtKB/TrEMBL:Q06VW2"
FT                   /protein_id="ABF57998.1"
FT                   /translation="MDSKESLAPPGRDEVPSSLLGRGRGSVMDLYKTLRGGATVKVSAS
FT                   SPSVAAASQADSKQQRILLDFSKGSASNAQQQQQQQQQQQQQQQQPQPDLSKAVSLSMG
FT                   LYMGETETKVMGNDLGYPQQGQLGLSSGETDFRLLEESIANLNRSTSRPENPKSSTPAA
FT                   GCATPTEKEFPQTHSDPSSEQQNRKSQPGTNGGSVKLYTTDQSTFDILQDLEFSAGSPG
FT                   KETNESPWRSDLLIDENLLSPLAGEDDPFLLEGDVNEDCKPLILPDTKPKIQDTGDTIL
FT                   SSPSSVALPQVKTEKDDFIELCTPGVIKQEKLGPVYCQASFSGTNIIGNKMSAISVHGV
FT                   STSGGQMYHYDMNTASLSQQQDQKPVFNVIPPIPVGSENWNRCQGSGEDNLTSLGAMNF
FT                   AGRSVFSNGYSSPGMRPDVSSPPSSSSTATGPPPKLCLVCSDEASGCHYGVLTCGSCKV
FT                   FFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAGMNLEARKTKKKIKGIQQ
FT                   ATAGVSQDTSENANKTIVPAALPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSAWRIMTT
FT                   LNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQASGNLL
FT                   CFAPDLIINEQRMTLPCMYDQCKHMLFISTELQRLQVSYEEYLCMKTLLLLSSVPKEGL
FT                   KSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHDVVENLLSYCFQT
FT                   FLDKSMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK"
FT   misc_difference 222
FT                   /gene="Nr3c1"
FT                   /replace="a"
FT                   /note="compared to NM_008173"
FT   misc_difference 247..270
FT                   /gene="Nr3c1"
FT                   /replace=""
FT                   /note="compared to NM_008173; CAG expansion; eight
FT                   additional CAG triplets"
FT   misc_difference 468
FT                   /gene="Nr3c1"
FT                   /replace="t"
FT                   /note="compared to NM_008173"
XX
SQ   Sequence 2376 BP; 692 A; 546 C; 568 G; 570 T; 0 other;
     atggactcca aagaatcctt agctccccct ggtagagacg aagtccccag cagtttgctt        60
     ggccggggga ggggaagcgt gatggacttg tataaaaccc tgaggggtgg agctacagtc       120
     aaggtttctg cgtcttcacc ctcagtggct gctgcttctc aggcagattc caagcagcag       180
     aggattctcc ttgatttttc aaaaggctca gcaagcaatg cgcagcagca gcagcagcag       240
     cagcagcagc agcagcagca gcagcagcag ccgcagccag atttatccaa agccgtttca       300
     ctgtccatgg gactgtatat gggagagacc gaaacaaaag tgatggggaa tgacttgggc       360
     tacccacagc agggccagct tggcctctcc tctggggaaa cagactttcg gcttctggaa       420
     gaaagcattg caaacctcaa taggtcgacc agccgtccag agaaccccaa gagttcaaca       480
     cctgcagctg ggtgtgctac cccgacagag aaggagtttc cccagactca ctctgatcca       540
     tcttcagaac agcaaaatag aaaaagccag cctggcacca acggtggcag tgtgaaattg       600
     tataccacag accaaagcac ctttgacatc ttgcaggatt tggagttttc tgccgggtcc       660
     ccaggtaaag agacaaacga gagtccttgg aggtcagacc tgttgataga tgaaaacttg       720
     ctttctcctt tggcgggaga agatgatcca ttccttctgg aaggggacgt gaatgaggat       780
     tgcaagcctc ttattttacc ggacactaaa cctaaaattc aggatactgg agatacaatc       840
     ttatcaagcc ccagcagtgt ggcactgccc caagtgaaaa cagagaaaga tgatttcatt       900
     gagctttgca cccctggggt aattaagcaa gagaaactgg gcccggttta ttgccaggca       960
     agcttttctg ggacaaatat aattgggaat aaaatgtctg ccatttctgt tcatggcgtg      1020
     agtacctctg gaggacagat gtaccactat gacatgaata cagcatccct ttctcagcag      1080
     caggatcaga agcctgtttt taatgtcatt ccaccaattc ctgttggttc tgaaaactgg      1140
     aataggtgcc aagggtctgg agaggacaac ctgacttcct tgggggctat gaacttcgca      1200
     ggccgctcag tgttttctaa tggatattca agccctggaa tgagaccaga tgtgagttct      1260
     cctccgtcca gctcctccac agcaacggga ccacctccca aactctgcct ggtgtgctcc      1320
     gatgaagctt cgggatgcca ttatggggtg ctgacgtgtg gaagctgtaa agtcttcttt      1380
     aaaagagcag tggaaggaca gcacaattac ctttgtgctg gaagaaatga ttgcatcatt      1440
     gataaaattc gaagaaaaaa ctgtccagca tgccgctatc gaaaatgtct tcaagctgga      1500
     atgaacctgg aagctcgaaa aacgaagaaa aaaattaaag gaattcagca agccactgca      1560
     ggagtctcac aagacacttc tgaaaacgct aacaaaacaa tagttcctgc cgcgctgcca      1620
     cagcttaccc ctaccctggt gtcactgctg gaggtgatcg agcctgaggt gttatatgca      1680
     ggatatgaca gctctgttcc agactcagca tggagaatta tgaccacgct caacatgtta      1740
     ggtgggcgcc aagtgattgc cgcagtgaaa tgggcaaagg cgataccagg attcagaaac      1800
     ttacacctgg atgaccaaat gacccttcta cagtactcat ggatgtttct catggcattt      1860
     gccctgggtt ggagatcata cagacaagca agtggaaacc tgctatgctt tgctcctgat      1920
     ctgattatta atgagcagag aatgactcta ccctgcatgt atgaccaatg taaacacatg      1980
     ctgtttatct ccactgaatt acaaagattg caggtatcct atgaagagta tctctgtatg      2040
     aaaaccttac tgcttctctc ctcagttcct aaggaaggtc tgaagagcca agagttattt      2100
     gatgagattc gaatgactta tatcaaagag ctaggaaaag ccattgtcaa aagggaagga      2160
     aactccagtc agaattggca gcggttttat caactgacaa aacttttgga ctccatgcat      2220
     gatgtggttg aaaatctcct tagctactgc ttccaaacat ttttggataa gtccatgagt      2280
     attgaattcc cagagatgtt agctgaaatc atcactaatc agataccaaa atactcaaat      2340
     ggaaatatca aaaagcttct gtttcatcag aaatga                                2376
//


spacer
spacer