spacer

EBI Dbfetch

ID   DQ486026; SV 1; linear; mRNA; STD; MUS; 819 BP.
XX
AC   DQ486026;
XX
DT   10-MAY-2006 (Rel. 87, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus adenylate kinase 1 (Ak1) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RC   Publication Status: Available-Online prior to print
RP   1-819
RX   DOI; 10.1095/biolreprod.106.053512.
RX   PUBMED; 16790685.
RA   Cao W., Haig-Ladewig L., Gerton G.L., Moss S.B.;
RT   "Adenylate kinases 1 and 2 are part of the accessory structures in the
RT   mouse sperm flagellum";
RL   Biol. Reprod. 75(4):492-500(2006).
XX
RN   [2]
RP   1-819
RA   Cao W., Haig-Ladewig L., Gerton G.L., Moss S.B.;
RT   ;
RL   Submitted (07-APR-2006) to the INSDC.
RL   Center for Research on Reproduction and Women's Health, University of
RL   Pennsylvania, 421 Curie Blvd, 1325 BRB II, Philadelphia, PA 19104, USA
XX
DR   MD5; 3454fa2d5c68a10869c296d503f958b8.
DR   Ensembl-Gn; ENSMUSG00000026817; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000068271; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113277; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113278; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..819
FT                   /organism="Mus musculus"
FT                   /chromosome="2"
FT                   /map="2A3-2B"
FT                   /strain="CD-1"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   gene            1..819
FT                   /gene="Ak1"
FT   CDS             165..749
FT                   /codon_start=1
FT                   /gene="Ak1"
FT                   /product="adenylate kinase 1"
FT                   /note="has a role in adenysine phosphate balance; mixed
FT                   germ cell-specific transcript"
FT                   /db_xref="GOA:Q9R0Y5"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006267"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028582"
FT                   /db_xref="MGI:MGI:87977"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9R0Y5"
FT                   /protein_id="ABF46940.1"
FT                   /translation="MEEKLKKAKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRA
FT                   EVSSGSERGKKLSAIMEKGELVPLDTVLDMLRDAMLAKVDSSNGFLIDGYPREVKQGEE
FT                   FEQKIGQPTLLLYVDAGAETMTQRLLKRGETSGRVDDNEETIKKRLETYYNATEPVISF
FT                   YDKRGIVRKVNAEGTVDTVFSEVCTYLDSLK"
XX
SQ   Sequence 819 BP; 221 A; 208 C; 228 G; 162 T; 0 other;
     ggaaacttcc agtgacatac tagtggtgtc gcgagcccct gtgggcacac ttccacctcc        60
     atgtaaaggc tgctgggaaa ctggatcctg tgtctgcata gaatttcttc cacgagcctc       120
     tgctcaccca cagagtgctg acctagctcc cagatctcag caggatggaa gagaagctga       180
     agaaggccaa gatcatcttt gtggtgggcg gacctggctc aggaaagggc acccagtgcg       240
     agaagattgt acagaaatat ggctacaccc acctgtctac tggggacctg cttcgggcag       300
     aagtcagctc tggatcggag aggggcaaga agctgtcggc tatcatggag aagggagagc       360
     tagtgccact ggacacggtg ctggacatgc tccgagatgc tatgttagcc aaagtggatt       420
     cttccaatgg cttcctgatc gacggctacc cgagggaggt gaaacaggga gaagaatttg       480
     aacagaagat tggacagccc acactgctgc tgtatgtgga cgcaggcgcc gagaccatga       540
     cccaacgact cctgaagcga ggggagacca gtggccgcgt ggatgacaac gaggagacca       600
     tcaagaagcg gctggagact tattacaatg ccacagaacc tgtcatctcc ttctatgaca       660
     agcgtggcat tgtgcgcaag gtcaatgccg aaggcacggt ggacactgtc ttctctgagg       720
     tctgcaccta tcttgactcc ctgaagtaac tggatccctt ggccagctcc caaacccgct       780
     ccataataaa cttgtgaact ccaaaaaaaa aaaaaaaaa                              819
//


spacer
spacer