spacer

EBI Dbfetch

ID   DQ390460; SV 1; linear; genomic DNA; STD; HUM; 388 BP.
XX
AC   DQ390460;
XX
DT   06-MAR-2006 (Rel. 87, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*14XX allele,
DE   exon 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-388
RX   DOI; 10.1111/j.1399-0039.2006.00669.x.
RX   PUBMED; 17026471.
RA   Chen Q., Zou H., Xu X.H., Luo M., Wang J., Zuo Y.Q., Chen Y.H., Chen X.H.,
RA   Chen X.L., Yao Z.Q., Song N., Zeng J., Mi X.Y., Sun S.X., Wang J.X.,
RA   Zhao T.M.;
RT   "Characterization of HLA-B*5516, -B*1313, -B*9512, and -DRB1*1457 alleles
RT   identified in a southwest Chinese population";
RL   Tissue Antigens 68(4):339-343(2006).
XX
RN   [2]
RP   1-388
RA   Chen Q., Zou H., Xu X.-H., Zuo Y.-Q., Luo M., Chen X.-H., Chen Y.-H.,
RA   Song N., Chen X.-L., Yao Z.-Q., Mi X.-Y., Wang J.-X., Zhao T.-M.;
RT   "Identification of a novel HLA-DRB1 allele (DRB1*14XX) with a DRB1*04
RT   sequence motif";
RL   Unpublished.
XX
RN   [3]
RP   1-388
RA   Chen Q., Zou H., Xu X.-H., Zuo Y.-Q., Luo M., Chen X.-H., Chen Y.-H.,
RA   Song N., Chen X.-L., Yao Z.-Q., Mi X.-Y., Wang J.-X., Zhao T.-M.;
RT   ;
RL   Submitted (06-FEB-2006) to the INSDC.
RL   MCIGS, NIAID, National Institutes of Health, Bldg#50, Rm 5511, 50 South
RL   Dr., Bethesda, MD 20892, USA
XX
DR   MD5; 97721ecf86df8a731f7b12dbc90c48be.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..388
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /clone="12973"
FT                   /db_xref="taxon:9606"
FT   gene            order(DQ390459.1:1..147,1..304)
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14XX"
FT   mRNA            <23..>304
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14XX"
FT                   /product="MHC class II antigen"
FT   CDS             <23..>304
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14XX"
FT                   /product="MHC class II antigen"
FT                   /note="leucocyte antigen"
FT                   /db_xref="GOA:Q9GIY3"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*14:57"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9GIY3"
FT                   /protein_id="ABD60301.1"
FT                   /translation="HPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKT
FT                   GVVSTGLIHNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEW"
FT   exon            23..304
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14XX"
FT                   /number=3
XX
SQ   Sequence 388 BP; 86 A; 108 C; 99 G; 95 T; 0 other;
     ccctctacct tttttctcct agtccatcct aaggtgactg tgtatccttc aaagacccag        60
     cccctgcagc accacaacct gctggtctgt tctgtgagtg gtttctatcc aggcagcatt       120
     gaagtcaggt ggttccggaa tggccaggaa gagaagactg gggtggtgtc cacaggcctg       180
     atccacaatg gagactggac cttccagacc ctggtgatgc tggaaacagt tcctcggagt       240
     ggagaggttt acacctgcca agtggagcac ccaagcgtga caagccctct cacagtggaa       300
     tggagtgagc agctttctga cttcataaat ttctcaccca ccaagaaggg gactgtgctc       360
     atccctgagt gtcaggtttc tcctctcc                                          388
//


spacer
spacer