spacer

EBI Dbfetch

ID   DQ346660; SV 1; linear; mRNA; STD; MUS; 2744 BP.
XX
AC   DQ346660;
XX
DT   12-SEP-2007 (Rel. 93, Created)
DT   12-SEP-2007 (Rel. 93, Last updated, Version 1)
XX
DE   Mus musculus regulator of G-protein signaling 4 transcript isoform b (Rgs4)
DE   mRNA, complete cds, alternatively spliced.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2744
RX   DOI; 10.1016/j.gene.2007.07.002.
RX   PUBMED; 17707117.
RA   Ding L., Mychaleckyj J.C., Hegde A.N.;
RT   "Full length cloning and expression analysis of splice variants of
RT   regulator of G-protein signaling RGS4 in human and murine brain";
RL   Gene 401(1-2):46-60(2007).
XX
RN   [2]
RP   1-2744
RA   Ding L., Mychaleckyj J.C., Hegde A.N.;
RT   ;
RL   Submitted (30-DEC-2005) to the INSDC.
RL   Neurobiology and Anatomy, Wake Forest Health Sciences, Medical Center Blvd,
RL   Winston-Salem, NC 27157, USA
XX
DR   MD5; 0faa0f848474a7acab291c4495645c84.
DR   Ensembl-Gn; ENSMUSG00000038530; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027991; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2744
FT                   /organism="Mus musculus"
FT                   /chromosome="1"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   gene            1..2744
FT                   /gene="Rgs4"
FT   5'UTR           1..119
FT                   /gene="Rgs4"
FT   CDS             120..737
FT                   /codon_start=1
FT                   /gene="Rgs4"
FT                   /product="regulator of G-protein signaling 4"
FT                   /db_xref="GOA:Q5D078"
FT                   /db_xref="InterPro:IPR000342"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="InterPro:IPR024066"
FT                   /db_xref="MGI:MGI:108409"
FT                   /db_xref="UniProtKB/TrEMBL:Q5D078"
FT                   /protein_id="ABC94588.1"
FT                   /translation="MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHSSSHSKKDKV
FT                   VTCQRVSQEEVKKWAESLENLIHHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSP
FT                   SKLSPKAKKIYNEFISVQATKEVNLDSCTREETSRNMLQPTITCFDEAQKKIFNLMEKD
FT                   SYRRFLKSRFYLDLTNPSSCGAEKQKGAKSSADCTSLVSQCA"
FT   misc_feature    303..650
FT                   /gene="Rgs4"
FT                   /note="Region: RGS domain"
FT   3'UTR           738..2744
FT                   /gene="Rgs4"
FT                   /note="transcript isoform b; alternatively spliced"
XX
SQ   Sequence 2744 BP; 759 A; 592 C; 615 G; 778 T; 0 other;
     agaggctcag aggattctga cagcttcttt gcagagcaga agcaactgtg ctcaaaatag        60
     aaaccaccgc ggctcccgct gcctttctct cctcgctaag aatccctcag ttaaacaaga       120
     tgtgcaaagg acttgcaggt ctgccggctt cctgcctgag gagtgcaaag gacatgaaac       180
     atcggctggg gttcctgctg cagaagtcag attcctgcga acacagttct tcacacagca       240
     agaaggacaa agtagtaact tgccagaggg taagccaaga agaagtcaag aaatgggctg       300
     aatcgttgga aaacctgatt caccatgaat gtggactggc agctttcaaa gctttcctga       360
     agtcggaata cagcgaggag aacattgact tctggatcag ctgtgaggag tacaagaaga       420
     tcaagtcacc ttctaaacta agtcccaaag ccaagaagat ctacaacgag ttcatctcag       480
     tgcaagcaac aaaagaggtg aacctggact cttgcaccag agaggagaca agccggaaca       540
     tgttacagcc cacaataacc tgttttgatg aagcccagaa gaagattttc aacctgatgg       600
     aaaaggattc ctaccgccgc ttcctcaagt ctcgattcta tcttgacctg accaatcctt       660
     ccagctgcgg ggcagagaag cagaaaggag ccaagagttc tgcagactgc acttccctgg       720
     tctcccagtg tgcctaattc tcacacagag gcagggagcc caaatgccaa gactctatgc       780
     tctgaaaaac ctgaggccaa atattgatct taagcaccaa tgctttatcc acattgtagc       840
     ctagtgtcca tgctgcctgc cgcgtgtgag tcacttccat gtaaaactag ccttagttgt       900
     ggtgttgggg ttttcactag ggtaagaccc aatttgtttt aaattttccc aagtctcctt       960
     aagggtgagc aagtttccaa ataatggctc cgtaggtctg gattttcaaa gatggctggc      1020
     agtctgcccc tttcaacagt ttgacctcaa gttagttagt tggtacactt catgtgacat      1080
     tccatgcaca tgtaatgttg gccagcagca cttcctacgg actctcaatg tttaggtgat      1140
     atttgtgtat gcatatgtat acattaaaat atacataaca tatgcatata cattctgtat      1200
     atattatacc tatgtattca atgtgtgtga atgtgcatga atatgtatct atctatctat      1260
     atatgtatat actgacacat gcacacacat ttctttaaga aaagatggga aagatcctag      1320
     gtgctcaaac tggagtgtgt agacatgctt gcatgcatgt tctgatttct ggtccttcat      1380
     accgtgtctg aacagggcaa actgaattaa ctgccatgca ggctaagaaa ggaacagtaa      1440
     cttgtgggga atgagttcta tagaaccact gggtcttggc ggagaatagc cagggccttt      1500
     gtgtttagtt gttgatggcc tccacattga gcactaagct aaggggtgag cactctgaaa      1560
     actctgctgt ctgactgaca ctgaactgcc ttgcatcagt gatcactact ggcacttttt      1620
     aagtccctct gctgatggcc ttccctcctt tgcctgggtg ctcagggtgt gctgattagc      1680
     agctgggttg gtctagagct gaatgtttga gctgaatgaa ggaatgtggt ccaggctttg      1740
     ctgcctagcc ctaccaagga ctactgctta ggtgagggca gaggacctaa agattatctt      1800
     aattctttcc tcttttgata aggtgctctt cttttccttc ccctcaagaa tgtcacctgt      1860
     cagaggagcc tccttagttc cctgtggttg gttgttcact ttaaaaacca cggctacctg      1920
     ccgtggttct aagctacatg cctacatctg taaagcatca tcggggggaa aggttatgtt      1980
     ttatcaggag gaaggaagtt ctcatgaact gcaaagccct ctttggtttt ctgctttgag      2040
     gtaagagctt gttcacccca tcccaaacac caaggctagc agagaccaat gaaaggagag      2100
     aggaaaggaa aaagaaagag aaaagaaaac agaagaggag aggctatcag ttggtaggac      2160
     tactgcttgg agcttttcaa ggcacgtgaa atacttgaaa atttctcatt tgtgttattt      2220
     atgatgtttt gtacagtgtt tttattattg tattgtttta taaatggagg tacaggatat      2280
     tacccaaatt attaatgaat gcccaagaag taatttcctt ctcattcttc taaaagtact      2340
     gcctttgaga gcacacacac attcgtgcaa cactgcagtc attgctccag tttaaattac      2400
     atgtgtgagc accattgtgg ctagtaagcc aatgtaccgg gctgcaaaat gaagacactg      2460
     gaatagtgtg tatccaagtc tcgtcgtatt gaagaaataa ttttctaagg gtactcgttt      2520
     cgtctctctt gacagtcttg cttgtaatgt ccccagagct cccccatcag tgttcctaac      2580
     tcctttttgt tatacacccc atccatgatc atgtctgtat aactctttgg tcttgcccta      2640
     atagtatcat gactttgaga ttgtacctgt actcacagac tgctgtttca caaataggtc      2700
     tggaaagtca ttctgaatga gaagtaaatt attttgtgta atac                       2744
//


spacer
spacer